BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20889 (622 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 7.8 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 23 7.8 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 23 7.8 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +1 Query: 127 AEGTAHLERHLFGSKLSFSTTVCPSK 204 AE T GSKLSF+ T+ PS+ Sbjct: 1434 AEMTIDTTHTADGSKLSFNITIKPSE 1459 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -3 Query: 233 VYDRYFCVRTFEGHTVVEKESFEPNK 156 V DR+ ++ GH + E+E + P++ Sbjct: 2084 VIDRFVRIQQENGHRITEEEYYLPDE 2109 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 23.0 bits (47), Expect = 7.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -3 Query: 374 DCTKSTLILHTFSFPVLRGDHXAH*FTFKC 285 +C K T IL +F VL GD KC Sbjct: 62 ECVKETGILPKNAFRVLSGDFSVDTMKAKC 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 615,960 Number of Sequences: 2352 Number of extensions: 11232 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 60214320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -