BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20882 (751 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 22 4.6 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 22 4.6 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 21 8.0 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 8.0 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 22.2 bits (45), Expect = 4.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = -2 Query: 282 WNSLFGYQ 259 WN LFGYQ Sbjct: 629 WNKLFGYQ 636 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 22.2 bits (45), Expect = 4.6 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 160 VFRTQHEVTAEGFVLDIPSSFQEFHLFLFLNL 255 V +++ G LDIP+S + HL L + L Sbjct: 32 VHEVDNQLKQMGCDLDIPNSVVQKHLILLMVL 63 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 21.4 bits (43), Expect = 8.0 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = -2 Query: 516 SQIWGNAKSM*SKTCLTGSSRSTLGAFRLSNYWSPFSPDL 397 +QI G + K C SR A R++ Y PD+ Sbjct: 50 NQIKGALPEIIGKNCERCDSRQVANARRIARYVQTKHPDV 89 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = +3 Query: 624 HGAPAILQKLDWIT*RVYVLAG 689 + PA+ Q LDWI Y G Sbjct: 2496 YDVPALSQYLDWIAVMTYDFHG 2517 Score = 21.4 bits (43), Expect = 8.0 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 400 SSQWVAIPIRWKIRRSTALAKA 335 S+QWV+ +IRR + L KA Sbjct: 2631 SNQWVSYDDIAEIRRKSRLVKA 2652 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,495 Number of Sequences: 336 Number of extensions: 3868 Number of successful extensions: 16 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -