BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20881 (774 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 160 1e-39 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 32 0.59 SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 30 2.4 SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) 29 4.2 SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) 29 4.2 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 5.5 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 160 bits (388), Expect = 1e-39 Identities = 72/85 (84%), Positives = 79/85 (92%) Frame = +2 Query: 254 QNPADVFVISSRPFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPA 433 +NPADV VIS+RP+GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAFREPRLLIV DP Sbjct: 69 ENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDPR 128 Query: 434 QDHQPITEASYVNIPVIALCNTDSP 508 DHQP+TEASYVNIPVIA CNTDSP Sbjct: 129 IDHQPVTEASYVNIPVIAFCNTDSP 153 Score = 101 bits (243), Expect = 5e-22 Identities = 43/65 (66%), Positives = 54/65 (83%) Frame = +1 Query: 505 PIRFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVLPRDQRWDVVVDLFFYRDPEESEK 684 P+R VD+AIPCN K HSIGLM+WLLAREVLR+RG + R W+++ DL+FYRDPEE+EK Sbjct: 153 PLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSISRALPWEIMPDLYFYRDPEEAEK 212 Query: 685 DEQQA 699 +EQ A Sbjct: 213 EEQAA 217 Score = 89.8 bits (213), Expect = 2e-18 Identities = 40/71 (56%), Positives = 49/71 (69%) Frame = +3 Query: 51 MSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTHVINLRRTWEKXXX 230 MSGGLD+L L EEDV K LAA HLGA N +FQME YVYKR++DG ++IN+++TWEK Sbjct: 1 MSGGLDILQLKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLL 60 Query: 231 XXXXXXXIRTP 263 I P Sbjct: 61 AARIIVTIENP 71 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 31.9 bits (69), Expect = 0.59 Identities = 16/45 (35%), Positives = 21/45 (46%) Frame = -2 Query: 650 KSTTTSQRWSRGSTPRSLSTSRANNHHIKPIEWEDLVLHGIAMST 516 K+TT RWS+G TP ++ H I L+ HG ST Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPST 1438 >SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.1 bits (67), Expect = 1.0 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -3 Query: 496 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRRST 332 V SN +V + N + CR Q NQ T FT + ++ C+T RN RS+ Sbjct: 876 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMRSS 930 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 29.9 bits (64), Expect = 2.4 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 553 HSIGLMWWLLAREVLRLRGVLP 618 H G +WW+L E LR + VLP Sbjct: 46 HDDGSVWWVLTSESLRAKAVLP 67 >SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) Length = 225 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 496 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRR 338 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 155 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 207 >SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) Length = 280 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 496 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRR 338 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 196 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 248 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 28.7 bits (61), Expect = 5.5 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 663 TVEEQINHNIPALVTGKHTTKPQHFTCQQPPHQTNRVGR-LGVAWDSNVHK 514 +V Q+ + P +T HT+ T P HQ + +GR G DSNV + Sbjct: 241 SVTNQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,337,145 Number of Sequences: 59808 Number of extensions: 607372 Number of successful extensions: 1495 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1491 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2107953584 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -