BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20876 (751 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g62360.1 68416.m07005 expressed protein 31 0.82 At5g18540.1 68418.m02192 periplasmic cytochrome C-related contai... 29 3.3 >At3g62360.1 68416.m07005 expressed protein Length = 1227 Score = 31.1 bits (67), Expect = 0.82 Identities = 17/46 (36%), Positives = 26/46 (56%) Frame = +1 Query: 310 GSATSAAFKVKKGGRYQMQVELCNSDGCSSSEGVEIVVADTDGSHL 447 G+ + +K GG + VEL +SDG S + V V+ +DGS+L Sbjct: 138 GAVGGESCLIKNGGPADVNVELLSSDG--SEDPVASVLTSSDGSYL 181 >At5g18540.1 68418.m02192 periplasmic cytochrome C-related contains weak similarity to periplasmic cytochrome C (GI:15594131) [Thermus thermophilus] Length = 111 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = -2 Query: 171 LTSTIANVRSPQPRFGIPGGPQEPTANAATAK 76 LTS ++ RS PR PGGP + AA AK Sbjct: 26 LTSLPSSSRSKPPRLAHPGGPLKTNKAAALAK 57 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,257,690 Number of Sequences: 28952 Number of extensions: 342721 Number of successful extensions: 923 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 897 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 923 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1663169840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -