BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20873 (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 26 1.4 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 9.6 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 25.8 bits (54), Expect = 1.4 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +3 Query: 282 TKGVVQLFNAVRNQQKSIEKEMDRNDLSEGKKEKILKKFDKRTFLD 419 +K V++ + RN QKS +K D E + I K D+RT L+ Sbjct: 917 SKLTVEIKTSERNVQKSKDKINSMEDEVEAAQSAIRKGNDERTQLE 962 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 597 VETLFHSSTDSLSQSFILAPIIK 529 + T FH++ DSL S +LA + K Sbjct: 612 IYTDFHAAFDSLPHSLLLAKLSK 634 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 610,700 Number of Sequences: 2352 Number of extensions: 11225 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -