BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20870 (755 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 24 5.8 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.8 bits (49), Expect = 5.8 Identities = 13/61 (21%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 366 EKAAWEETKM-YGWQDFQDFTLRRMFKKYSQLGVAALPDDKFQALMRTVLEWNRTTPLRR 542 E+A W+ YGW + + R K YS + ++ +R++++ R R Sbjct: 14 EEALWKLILAPYGWDEQMNEAAREFLKNYSDFIPMLIGQSHYKIDLRSLIKEARANKWRN 73 Query: 543 S 545 + Sbjct: 74 T 74 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 679,559 Number of Sequences: 2352 Number of extensions: 12158 Number of successful extensions: 26 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78170964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -