BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20868 (852 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) 124 7e-29 SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 5e-23 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 104 8e-23 SB_35139| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.90 SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) 30 2.1 SB_58571| Best HMM Match : PLAT (HMM E-Value=1.2e-22) 29 6.3 SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_41164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_38812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.4 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 28 8.4 SB_36630| Best HMM Match : DUF1312 (HMM E-Value=0.67) 28 8.4 >SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) Length = 265 Score = 124 bits (300), Expect = 7e-29 Identities = 56/85 (65%), Positives = 70/85 (82%) Frame = +3 Query: 255 VLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFI 434 V+ S DS ++HLAW N PRK+GG+G +NIP++SD + +IS+DYGVL E+ G+ RGLFI Sbjct: 118 VIACSVDSEYSHLAWTNVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFI 177 Query: 435 IDDKQNLRQITINDLPVGRSVEETL 509 IDDK LRQITINDLPVGRSV+ETL Sbjct: 178 IDDKGILRQITINDLPVGRSVDETL 202 Score = 107 bits (257), Expect = 1e-23 Identities = 51/79 (64%), Positives = 61/79 (77%), Gaps = 4/79 (5%) Frame = +1 Query: 31 KVFSFNKMPLQMT---KPAPQFKATAV-VNGEFKDISLSDYKGKYVVLFFYPLDFTFVCP 198 ++ SF++ + T KPAP F TAV +GEF D+ LSDYKGKYVVLFFYPLDFTFVCP Sbjct: 39 RMMSFSRADMSKTAIQKPAPAFSGTAVNKHGEFIDLKLSDYKGKYVVLFFYPLDFTFVCP 98 Query: 199 TEIIAFSEKADEFRKIGCE 255 TEIIAFS++ DEF+ I CE Sbjct: 99 TEIIAFSDRVDEFKAINCE 117 Score = 58.0 bits (134), Expect = 9e-09 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 509 RLVQAFQFTDKHGEVCPANWRPGAKT 586 RL+QAFQFTDKHGEVCPA WRPGA T Sbjct: 203 RLIQAFQFTDKHGEVCPAGWRPGADT 228 >SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 105 bits (252), Expect = 5e-23 Identities = 45/65 (69%), Positives = 57/65 (87%) Frame = +1 Query: 61 QMTKPAPQFKATAVVNGEFKDISLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFR 240 Q++KPAP ++ TAVVNGEFK++ LSD++GKY+V FFYPLDFTFVCPTEIIAFS++ +EFR Sbjct: 55 QISKPAPFWEGTAVVNGEFKELKLSDFEGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFR 114 Query: 241 KIGCE 255 I E Sbjct: 115 AINTE 119 Score = 53.2 bits (122), Expect = 3e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 423 GLFIIDDKQNLRQITINDLPVGRSVEETL 509 GLFIIDDK LRQIT+NDLPVGRSV+ETL Sbjct: 135 GLFIIDDKGVLRQITMNDLPVGRSVDETL 163 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 255 VLGASTDSHFTHLAW 299 V+G S DS FTHLAW Sbjct: 120 VVGCSVDSVFTHLAW 134 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +2 Query: 509 RLVQAFQFTDKH 544 RLVQAFQ+TDKH Sbjct: 164 RLVQAFQYTDKH 175 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 104 bits (250), Expect = 8e-23 Identities = 48/69 (69%), Positives = 59/69 (85%) Frame = +3 Query: 303 NTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFIIDDKQNLRQITINDLP 482 N PRK+GG+G +NIP++SD + +IS+DYGVL E+ G+ RGLFIIDDK LRQITINDLP Sbjct: 3 NVPRKKGGIGNINIPILSDLTKQISKDYGVLLEDQGVALRGLFIIDDKGILRQITINDLP 62 Query: 483 VGRSVEETL 509 VGRSV+ETL Sbjct: 63 VGRSVDETL 71 Score = 58.0 bits (134), Expect = 9e-09 Identities = 23/26 (88%), Positives = 24/26 (92%) Frame = +2 Query: 509 RLVQAFQFTDKHGEVCPANWRPGAKT 586 RL+QAFQFTDKHGEVCPA WRPGA T Sbjct: 72 RLIQAFQFTDKHGEVCPAGWRPGADT 97 >SB_35139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 64.1 bits (149), Expect = 1e-10 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +2 Query: 509 RLVQAFQFTDKHGEVCPANWRPGAKTIKPDTKAAQEYF 622 RLVQAFQ+TDKHGEVCPA W+PG TI PD ++YF Sbjct: 10 RLVQAFQYTDKHGEVCPAGWKPGKDTIIPDPTQKKKYF 47 >SB_3733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1755 Score = 31.5 bits (68), Expect = 0.90 Identities = 15/59 (25%), Positives = 26/59 (44%) Frame = +2 Query: 311 AQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPARG 487 + AG + +R+ A H PR+ G G+ HS+P + +P + P +G Sbjct: 18 SSAGEESLADSGEGRRENARHKPRVMIGGEGEKHSVPAVITIPSVTDPGVAEGRPPRKG 76 >SB_49729| Best HMM Match : Vps54 (HMM E-Value=3.7) Length = 353 Score = 30.3 bits (65), Expect = 2.1 Identities = 16/54 (29%), Positives = 23/54 (42%) Frame = +2 Query: 335 HEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPARGEVG 496 H+ + K + P LP ++ R + L LH EP A + P R E G Sbjct: 151 HKWRNLKEVLVPSLPERQTGQRNRTNKLLMNLHRVTSPEPPATRPKHPGRVEAG 204 >SB_58571| Best HMM Match : PLAT (HMM E-Value=1.2e-22) Length = 651 Score = 28.7 bits (61), Expect = 6.3 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = +3 Query: 174 FGLHVRVPDGDHRVLGEGGRVPQDRLRVLGASTDSHFTHLAWINTPRKQGG 326 + + + G H+ G RV ++++G+ +DSH T L N PR Q G Sbjct: 461 YSYEISIHTGFHQGCGTTARV---YIQLIGSISDSHTTELRDANRPRFQRG 508 >SB_50216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3293 Score = 28.3 bits (60), Expect = 8.4 Identities = 18/61 (29%), Positives = 24/61 (39%) Frame = +2 Query: 302 QHAAQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPA 481 QH+ T P + SS +Q PH P R R T H+ + PQ+ A Sbjct: 784 QHSESVSETSP-QLSSTAQQTPPHSPATRHNARTSSPQSLATRHNAWTSSPQSPATLHNA 842 Query: 482 R 484 R Sbjct: 843 R 843 >SB_41164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 341 HSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPARGE 490 HSS K+ + RLRSA G+ ++P+T Q P H + P+ G+ Sbjct: 38 HSSKKKGLVK-TKRLRSASVGEAQNMPKTT--AGQLRPSRRHLKAPSTGK 84 >SB_38812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 138 LQGEICCAVLLSFGLHVRVPDGDHRVLGEGGRVPQDRLRVLGASTDSHFTH 290 L+ ++ L +H P+ D V +GGR+P+ +L D ++ H Sbjct: 20 LERKVTVIRLAESKIHNHKPEHDIDVHSQGGRLPKTKLHASKEQMDDYYRH 70 >SB_37636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 28.3 bits (60), Expect = 8.4 Identities = 17/57 (29%), Positives = 21/57 (36%) Frame = +2 Query: 314 QAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPAR 484 Q GR RP++H V H PR R R S P + R H + R Sbjct: 147 QTGRMRPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPR 203 >SB_17596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 8.4 Identities = 19/68 (27%), Positives = 24/68 (35%) Frame = +2 Query: 314 QAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPARGEV 493 + GR RP++H V H PR R R S P + R H + R Sbjct: 43 KTGRMRPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGP 102 Query: 494 GGGDPRLV 517 G R V Sbjct: 103 GHDKRRTV 110 >SB_13940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 28.3 bits (60), Expect = 8.4 Identities = 19/68 (27%), Positives = 24/68 (35%) Frame = +2 Query: 314 QAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPARGEV 493 + GR RP++H V H PR R R S P + R H + R Sbjct: 43 KTGRMRPYDHQRRGCIVRNHRPRDRQQSRRTARSPPHSTTDREDGTLAERHAPQAPRSGP 102 Query: 494 GGGDPRLV 517 G R V Sbjct: 103 GHDKRRTV 110 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 28.3 bits (60), Expect = 8.4 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 471 NDLPVGRSVEETLGWCRPSSSRTST 545 N PV R +T GWC+P S T Sbjct: 74 NKSPVIRKCRKTCGWCKPPSPEKQT 98 >SB_36630| Best HMM Match : DUF1312 (HMM E-Value=0.67) Length = 241 Score = 28.3 bits (60), Expect = 8.4 Identities = 13/51 (25%), Positives = 24/51 (47%) Frame = +3 Query: 138 LQGEICCAVLLSFGLHVRVPDGDHRVLGEGGRVPQDRLRVLGASTDSHFTH 290 L+ ++ L +H P+ D V +GGR+P+ +L D ++ H Sbjct: 167 LERKVTVIRLAESKIHNHKPEHDIDVHSQGGRLPKTKLHASKEQMDDYYRH 217 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,999,722 Number of Sequences: 59808 Number of extensions: 463887 Number of successful extensions: 1618 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1616 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2419355818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -