BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20868 (852 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1)... 102 3e-22 At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putat... 101 6e-22 At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to pe... 49 5e-06 At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putati... 36 0.026 At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol spe... 32 0.56 At5g57370.1 68418.m07168 expressed protein low similarity to nuc... 31 1.3 At5g61850.1 68418.m07760 floral meristem identity control protei... 30 1.7 At2g16970.1 68415.m01955 expressed protein ; expression support... 29 5.2 At1g80910.1 68414.m09493 expressed protein 29 5.2 At3g62170.1 68416.m06985 pectinesterase family protein contains ... 28 6.9 At5g09840.1 68418.m01138 expressed protein contains Pfam profile... 28 9.1 At4g16146.1 68417.m02449 expressed protein 28 9.1 At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) ... 28 9.1 >At3g11630.1 68416.m01425 2-cys peroxiredoxin, chloroplast (BAS1) identical to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 266 Score = 102 bits (245), Expect = 3e-22 Identities = 48/85 (56%), Positives = 62/85 (72%) Frame = +3 Query: 255 VLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFI 434 VLG S DS F+HLAW+ T RK GGLG +N PLISD + IS+ +GVL + GI RGLFI Sbjct: 140 VLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSISKSFGVLIHDQGIALRGLFI 199 Query: 435 IDDKQNLRQITINDLPVGRSVEETL 509 ID + ++ TIN+L +GRSV+ET+ Sbjct: 200 IDKEGVIQHSTINNLGIGRSVDETM 224 Score = 84.2 bits (199), Expect = 1e-16 Identities = 42/69 (60%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = +1 Query: 52 MPLQMTKPAPQFKATAVVNGEFKDISLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSEKA 228 +PL K AP F+A AV + EF + LSDY GK YV+LFFYPLDFTFVCPTEI AFS++ Sbjct: 72 LPLVGNK-APDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRH 130 Query: 229 DEFRKIGCE 255 EF K+ E Sbjct: 131 SEFEKLNTE 139 Score = 49.6 bits (113), Expect = 3e-06 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +2 Query: 509 RLVQAFQFTDKH-GEVCPANWRPGAKTIKPDTKAAQEYF 622 R +QA Q+ ++ EVCPA W+PG K++KPD K ++EYF Sbjct: 225 RTLQALQYIQENPDEVCPAGWKPGEKSMKPDPKLSKEYF 263 >At5g06290.1 68418.m00705 2-cys peroxiredoxin, chloroplast, putative very strong similarity to SP|Q96291 2-cys peroxiredoxin BAS1, chloroplast precursor {Arabidopsis thaliana}; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 273 Score = 101 bits (242), Expect = 6e-22 Identities = 47/85 (55%), Positives = 62/85 (72%) Frame = +3 Query: 255 VLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGLFI 434 VLG S DS F+HLAW+ T RK GGLG +N PL+SD + IS+ +GVL + GI RGLFI Sbjct: 147 VLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVSDITKSISKSFGVLIPDQGIALRGLFI 206 Query: 435 IDDKQNLRQITINDLPVGRSVEETL 509 ID + ++ TIN+L +GRSV+ET+ Sbjct: 207 IDKEGVIQHSTINNLGIGRSVDETM 231 Score = 83.4 bits (197), Expect = 2e-16 Identities = 41/69 (59%), Positives = 51/69 (73%), Gaps = 1/69 (1%) Frame = +1 Query: 52 MPLQMTKPAPQFKATAVVNGEFKDISLSDYKGK-YVVLFFYPLDFTFVCPTEIIAFSEKA 228 +PL K AP F+A AV + EF + LS+Y GK YV+LFFYPLDFTFVCPTEI AFS++ Sbjct: 79 LPLVGNK-APDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPLDFTFVCPTEITAFSDRY 137 Query: 229 DEFRKIGCE 255 +EF K+ E Sbjct: 138 EEFEKLNTE 146 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = +2 Query: 509 RLVQAFQFTDKH-GEVCPANWRPGAKTIKPDTKAAQEYF 622 R +QA Q+ ++ EVCPA W+PG K++KPD K ++EYF Sbjct: 232 RTLQALQYVQENPDEVCPAGWKPGEKSMKPDPKLSKEYF 270 >At3g26060.1 68416.m03245 peroxiredoxin Q, putative similar to peroxiredoxin Q [Sedum lineare] GI:6899842; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 48.8 bits (111), Expect = 5e-06 Identities = 22/46 (47%), Positives = 29/46 (63%) Frame = +1 Query: 118 KDISLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCE 255 K +SL YKGK VVL+FYP D T C + AF + ++F+K G E Sbjct: 86 KPVSLKKYKGKPVVLYFYPADETPGCTKQACAFRDSYEKFKKAGAE 131 Score = 31.1 bits (67), Expect = 0.97 Identities = 21/86 (24%), Positives = 44/86 (51%), Gaps = 1/86 (1%) Frame = +3 Query: 255 VLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETG-IPFRGLF 431 V+G S D +H A+ + + + L+SD+ +++ +D+GV + G +P R + Sbjct: 132 VIGISGDDSASHKAFASKYK-------LPYTLLSDEGNKVRKDWGVPGDLFGALPGRQTY 184 Query: 432 IIDDKQNLRQITINDLPVGRSVEETL 509 ++D ++ I N + ++ETL Sbjct: 185 VLDKNGVVQLIYNNQFQPEKHIDETL 210 >At1g48130.1 68414.m05371 peroxiredoxin (PER1) / rehydrin, putative identical to peroxiredoxin (Rehydrin homolog) [Arabidopsis thaliana] SWISS-PROT:O04005; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 216 Score = 36.3 bits (80), Expect = 0.026 Identities = 20/41 (48%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = +1 Query: 130 LSDY-KGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIG 249 L DY + VLF +P DFT VC TE+ A ++ A EF K G Sbjct: 24 LHDYFANSWTVLFSHPGDFTPVCTTELGAMAKYAHEFDKRG 64 Score = 36.3 bits (80), Expect = 0.026 Identities = 21/87 (24%), Positives = 38/87 (43%) Frame = +3 Query: 249 LRVLGASTDSHFTHLAWINTPRKQGGLGPMNIPLISDKSHRISRDYGVLDEETGIPFRGL 428 +++LG S D +H WI +N P+I+D + I ++D P R L Sbjct: 65 VKLLGLSCDDVQSHKDWIKDIEAFNHGSKVNYPIIADPNKEIIPQLNMIDPIENGPSRAL 124 Query: 429 FIIDDKQNLRQITINDLPVGRSVEETL 509 I+ ++ + GR+++E L Sbjct: 125 HIVGPDSKIKLSFLYPSTTGRNMDEVL 151 >At3g06050.1 68416.m00692 alkyl hydroperoxide reductase/thiol specific antioxidant (AhpC/TSA)/mal allergen family protein identical to SP|Q9M7T0 Putative peroxiredoxin, mitochondrial precursor {Arabidopsis thaliana}; similar to thioredoxin peroxidase [Capsicum annuum] GI:18654477; contains Pfam profile: PF00578 AhpC/TSA (alkyl hydroperoxide reductase and thiol-specific antioxidant) family Length = 201 Score = 31.9 bits (69), Expect = 0.56 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +1 Query: 103 VNGEFKDISLSD-YKGKYVVLFFYPLDFTFVCPTE-IIAFSEKADEFRKIGCE 255 V+ +F LSD +KGK VV+F P +T VC + + ++ D+F+ G + Sbjct: 58 VSSKFSTTPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAKGID 110 >At5g57370.1 68418.m07168 expressed protein low similarity to nucleic acid binding protein [Homo sapiens] GI:431953 Length = 219 Score = 30.7 bits (66), Expect = 1.3 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 2/59 (3%) Frame = +2 Query: 323 RTRPHEHSSDKRQV-APHLPRLRSAGRGDGHSLPRTLHHRRQA-EPQADHDQRPARGEV 493 R+R +H + R V +P R RS R HHRR++ P A +RP +G V Sbjct: 54 RSRTPDHHARARHVRSPERYRSRSRSIDRDRDRDRQRHHRRRSPSPDAPSRKRPRQGSV 112 >At5g61850.1 68418.m07760 floral meristem identity control protein LEAFY (LFY) identical to PIR|B38104 LFY floral meristem identity control protein, splice form 2 - Arabidopsis thaliana; contains Pfam profile PF01698: Floricaula / Leafy protein Length = 420 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/65 (29%), Positives = 24/65 (36%) Frame = +2 Query: 308 AAQAGRTRPHEHSSDKRQVAPHLPRLRSAGRGDGHSLPRTLHHRRQAEPQADHDQRPARG 487 A +A R R E ++ HL + G H+L EP DQ A G Sbjct: 110 AVRAERRRLQEEEEEESSRRRHLLLSAAGDSGTHHALDALSQEGLSEEPVQQQDQTDAAG 169 Query: 488 EVGGG 502 GGG Sbjct: 170 NNGGG 174 >At2g16970.1 68415.m01955 expressed protein ; expression supported by MPSS Length = 414 Score = 28.7 bits (61), Expect = 5.2 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -1 Query: 657 IVGVVSCLVASPKYSWAALVSGLMVLAPGLQLAGHTSPCLSVNWKA 520 I+G +S L PK + + VL+ GL + + CLSV+W A Sbjct: 258 IIGSISQLFILPKL--VSAIGERRVLSTGLLMDSVNAACLSVSWSA 301 >At1g80910.1 68414.m09493 expressed protein Length = 497 Score = 28.7 bits (61), Expect = 5.2 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 121 DISLSDYKGKYV--VLFFYPLDFTFVCPTEIIAFSEKADEFRKI 246 D+ ++G+ + +LFFYP D TF +I SE F ++ Sbjct: 19 DLRRGQHEGQELDKILFFYPPDLTFSTQLSVIGLSEGLITFTRL 62 >At3g62170.1 68416.m06985 pectinesterase family protein contains Pfam profiles: PF01095 pectinesterase, PF04043 plant invertase/pectin methylesterase inhibitor ;similar to pollen-specific pectin esterase GI:1620652 from [Brassica rapa subsp. pekinensis] Length = 588 Score = 28.3 bits (60), Expect = 6.9 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -1 Query: 156 NIFPLVVRQRNVLELSVDDGRGLELGSGFGHLQRHLVETKD 34 +IF VV + + VDD + + +G+G G R L+E D Sbjct: 192 DIFHSVVTAMAQMGVKVDDMKNITMGAGAGGAARRLLEDND 232 >At5g09840.1 68418.m01138 expressed protein contains Pfam profile PF04396: Protein of unknown function, DUF537 Length = 924 Score = 27.9 bits (59), Expect = 9.1 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -1 Query: 741 IISFFFQFLNILHFQRCALFEIVYSIRVIVGVVSCLVASPKYSWAALVSG 592 +IS +F ++LH R + I+ + + V C AS + W AL+ G Sbjct: 170 LISSDKEFASVLHRLRMNNYNILLASKSSAPGVLCSAASIMWDWDALIKG 219 >At4g16146.1 68417.m02449 expressed protein Length = 102 Score = 27.9 bits (59), Expect = 9.1 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = +3 Query: 315 KQGGLGPMNIPLISDKSHRI---SRDYGVLDEETGIPFRGLFIID 440 K GGL P PLIS S R S D+ +L +E I R + I+ Sbjct: 25 KYGGLVPKKKPLISKDSKRAFFDSADWALLKQEASIDQRTIAAIE 69 >At3g57670.1 68416.m06425 zinc finger (C2H2 type) protein (WIP2) identical to WIP2 protein [Arabidopsis thaliana] gi|18027012|gb|AAL55722; contains Pfam domain, PF00096: Zinc finger, C2H2 type Length = 383 Score = 27.9 bits (59), Expect = 9.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 413 SLPRTLHHRRQAEPQADHDQRPARGEVGGGD 505 S RT HH + D D + G VGGG+ Sbjct: 149 SSSRTTHHHEDMNHKKDLDHEYSHGAVGGGE 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,944,425 Number of Sequences: 28952 Number of extensions: 317486 Number of successful extensions: 1067 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1026 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1065 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1980143200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -