BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20865 (792 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 23 2.1 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 6.5 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 23.4 bits (48), Expect = 2.1 Identities = 22/71 (30%), Positives = 31/71 (43%), Gaps = 1/71 (1%) Frame = +1 Query: 88 LPHCQSSFPPTTPASVQRK-PLSSKLFPSLPKFQRVLLKSSTMYTS*SPVTRLELLNHPS 264 +P Q + P Q K PLSS +PS+ ++L+ S M S RL L +P+ Sbjct: 1 MPLLQETTPKRDMLDSQEKTPLSSVSYPSMFTPSQLLMASHLMAAS-----RLSLPTNPA 55 Query: 265 QHVEHLSILIW 297 L L W Sbjct: 56 FFHPGLLPLAW 66 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 6.5 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 402 LATPAWNLARRSSGLMSRISGAKIVPESYTCLTT 301 L+TP+ + A +SSGL S +S + P TT Sbjct: 129 LSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTT 162 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,173 Number of Sequences: 336 Number of extensions: 3784 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -