BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20845 (726 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0046 + 14411844-14413154,14413753-14413800,14413879-144139... 29 5.0 03_02_0003 - 4862220-4863428 29 5.0 >10_08_0046 + 14411844-14413154,14413753-14413800,14413879-14413992, 14414218-14414496,14414602-14414715,14415210-14415282, 14415973-14416073 Length = 679 Score = 28.7 bits (61), Expect = 5.0 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 3/52 (5%) Frame = -1 Query: 588 KLLLFQGNLSF*APFLYQDHKSLYLL---LIKIYSACYQLQERVLTSFRFAA 442 +L+L LSF + LY+L LI ++S+C + E++LT++R A+ Sbjct: 583 QLVLIDFGLSFISTIPEDKAVDLYVLERALISMHSSCGDVMEKILTAYRKAS 634 >03_02_0003 - 4862220-4863428 Length = 402 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 262 INMIIEHLNTKDWNQEKLIAFLDLLKKKLSDIVLMSIYHHNCSYGEVITSFD 417 I + NT+ +EK I +LD+ + DI + IYH Y ++ + D Sbjct: 20 ITQKVTGFNTETTTKEKPIGYLDVFVHQARDIHNICIYHKQDVYAKLCLTSD 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,829,070 Number of Sequences: 37544 Number of extensions: 262176 Number of successful extensions: 521 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 521 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -