BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20791 (773 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 22 4.7 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.3 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.3 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 8.3 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/37 (24%), Positives = 18/37 (48%) Frame = +2 Query: 659 SHNKLEPHTNNKVSRPDYWQVDWLSSSWR*LDWYVWW 769 +HN + N+ Y+ WL ++ LD +++W Sbjct: 406 NHNFDRHYEENRAPLGLYFHAAWLKNNPEFLDAFLYW 442 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 488 CWLWRQ*VYVFN 523 CWL + +YVFN Sbjct: 224 CWLISKCIYVFN 235 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 699 LTLLLVCGSNLLCD 658 +TL+ +CG L+CD Sbjct: 283 ITLVAMCGLVLICD 296 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 8.3 Identities = 7/12 (58%), Positives = 9/12 (75%) Frame = +2 Query: 488 CWLWRQ*VYVFN 523 CWL + +YVFN Sbjct: 224 CWLISKCIYVFN 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,721 Number of Sequences: 336 Number of extensions: 4315 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20857569 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -