BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS20737 (432 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 109 1e-24 SB_16496| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_49920| Best HMM Match : MANEC (HMM E-Value=0.73) 27 5.0 SB_33032| Best HMM Match : Prothymosin (HMM E-Value=0.78) 27 6.6 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 109 bits (262), Expect = 1e-24 Identities = 48/71 (67%), Positives = 59/71 (83%) Frame = +1 Query: 46 MSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTHVINLRRTWEKLVL 225 MSGGLD+L L EEDV K LAA HLGA N +FQME YVYKR++DG ++IN+++TWEKL+L Sbjct: 1 MSGGLDILQLKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLL 60 Query: 226 AARAVVAIENP 258 AAR +V IENP Sbjct: 61 AARIIVTIENP 71 Score = 108 bits (260), Expect = 2e-24 Identities = 49/57 (85%), Positives = 54/57 (94%) Frame = +3 Query: 255 PADVFVISSRPFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDP 425 PADV VIS+RP+GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAFREPRLLIV DP Sbjct: 71 PADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDP 127 >SB_16496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1275 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 211 EKLVLAARAVVAIENPLMCSSSHHGPSVSVL 303 +K+ LA RA VAI+ L C + +HG V+ Sbjct: 482 DKVYLATRATVAIKIVLQCDTRYHGQQNKVI 512 >SB_3365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 335 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 211 EKLVLAARAVVAIENPLMCSSSHHGPSVSVL 303 +K+ LA RA VAI+ L C + +HG V+ Sbjct: 267 DKVYLATRATVAIKIVLQCDTRYHGQQNKVI 297 >SB_49920| Best HMM Match : MANEC (HMM E-Value=0.73) Length = 139 Score = 27.5 bits (58), Expect = 5.0 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +3 Query: 156 CLQTTC*WYPCD-QLASYLGKTCSGCSC 236 C+Q C CD + SY G+TC G +C Sbjct: 87 CVQRCCDVLHCDLAMMSYGGRTCYGVAC 114 >SB_33032| Best HMM Match : Prothymosin (HMM E-Value=0.78) Length = 508 Score = 27.1 bits (57), Expect = 6.6 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +3 Query: 96 NACCNHPSWGRKC*LPDGDLC 158 N CC H SW +C PD +C Sbjct: 406 NPCCAHQSWRAEC--PDEGVC 424 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,766,582 Number of Sequences: 59808 Number of extensions: 312446 Number of successful extensions: 788 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 651 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 822495283 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -