BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312G10f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27757| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 1e-16 SB_50597| Best HMM Match : 7tm_1 (HMM E-Value=2.59941e-42) 29 2.3 SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) 28 4.1 SB_9321| Best HMM Match : DDE (HMM E-Value=5.40004e-41) 28 5.4 SB_38407| Best HMM Match : DDE (HMM E-Value=5.40004e-41) 28 5.4 SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) 27 7.1 SB_41383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) 27 9.4 SB_23490| Best HMM Match : DDE (HMM E-Value=2.1e-33) 27 9.4 SB_5056| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_27757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 344 Score = 83.0 bits (196), Expect = 1e-16 Identities = 40/94 (42%), Positives = 60/94 (63%) Frame = +3 Query: 114 PGSGVPRQQIRLNQLHLTKFRLKYAFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANKEK 293 P GV RQ I + L LT F++K +A + V+KA+ A++ +KW ++ WA+KLA ++K Sbjct: 249 PHGGVCRQAINMKHLSLTDFKIKIGRSARSGPVKKAFEAAQVQDKWEQTAWARKLAMRKK 308 Query: 294 RAQMTDYDRFKLTAARVKRNRARTAVFKSLKVKA 395 RA + D+DRFKL A+ K+NR K LK +A Sbjct: 309 RATLNDFDRFKLKLAKQKKNRLLRTEVKKLKKEA 342 >SB_50597| Best HMM Match : 7tm_1 (HMM E-Value=2.59941e-42) Length = 347 Score = 29.1 bits (62), Expect = 2.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -2 Query: 187 AYLRRNFVRWSWFKRICCLGTPLPGPSTSARVWSITSTTLTNF 59 AY+ R++ WS+ K C + P+ S S + +IT TL + Sbjct: 87 AYIIRDYFSWSFGKIACQIIIPMNDVSFSVSICTITVITLERY 129 >SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) Length = 337 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +3 Query: 30 ALVADGPLKGKLVSVVDVIDQTRALVDGPGSGVPRQQIR-LNQLHLTKF 173 +L+ D L + VS VDV + A+VD P + RQ ++ ++ H F Sbjct: 70 SLIGDYDLFAREVSTVDVRIASHAIVDRPRASWKRQSLKGISNFHFLAF 118 >SB_9321| Best HMM Match : DDE (HMM E-Value=5.40004e-41) Length = 700 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 208 RRVGAVNAYLRRNFVRWSWFKRICCLGTPLPGP 110 +RV +AY N + W W++R+ G + GP Sbjct: 122 KRVCTRSAYSDINRLAWQWYERMRAQGNQISGP 154 >SB_38407| Best HMM Match : DDE (HMM E-Value=5.40004e-41) Length = 700 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 208 RRVGAVNAYLRRNFVRWSWFKRICCLGTPLPGP 110 +RV +AY N + W W++R+ G + GP Sbjct: 122 KRVCTRSAYSDINRLAWQWYERMRAQGNQISGP 154 >SB_46755| Best HMM Match : zf-C2H2 (HMM E-Value=1.09301e-43) Length = 1806 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +1 Query: 88 TKLVHWLMDPAVEYLGNRSA*TNSISQNSASNTRSQPLLVS*GK 219 T L+ MDP+V LG+R + ++S+ T + L+S GK Sbjct: 265 TVLLSKFMDPSVHNLGSRVTARRVVQESSSRTTPIRQALLSVGK 308 >SB_41383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -2 Query: 178 RRNFVRWSWFKRICCLGTPLPGPSTSARVWSITST 74 R N W WF R + P+ GP A+ T Sbjct: 74 RINDAIWEWFTRCRAMNIPITGPMIQAQALKYAET 108 >SB_12635| Best HMM Match : Chlam_PMP (HMM E-Value=0.018) Length = 3561 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -1 Query: 383 QALEYGSPGTVPLNSCSC*LEPIVICHLCALF 288 + L Y +P V + S SC L P IC+ C +F Sbjct: 3132 RGLRYTAPNGVTVTS-SCGLAPCSICYSCYMF 3162 >SB_23490| Best HMM Match : DDE (HMM E-Value=2.1e-33) Length = 497 Score = 27.1 bits (57), Expect = 9.4 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = -2 Query: 178 RRNFVRWSWFKRICCLGTPLPGPSTSARVWSITST 74 R N W WF R + P+ GP A+ T Sbjct: 72 RINDAIWEWFTRCRAMNIPITGPMIQAQALKYAET 106 >SB_5056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 726 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/69 (24%), Positives = 30/69 (43%) Frame = +3 Query: 108 DGPGSGVPRQQIRLNQLHLTKFRLKYAFTAPTRLVRKAWTDAKLNEKWTESQWAQKLANK 287 D G G R + LN +H+ + Y +V + TDA+ + W E +W K+ Sbjct: 456 DVSGGGGDRNCVVLNDIHIDI--MDY-------IVPASCTDAEFRQMWAEFEWENKVTVN 506 Query: 288 EKRAQMTDY 314 + + +Y Sbjct: 507 TNISDLREY 515 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,207,615 Number of Sequences: 59808 Number of extensions: 340229 Number of successful extensions: 1013 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1012 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -