BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F10f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g41830.1 68418.m05093 F-box family protein-related contains a... 28 3.3 At2g32490.1 68415.m03970 3'-5' exonuclease domain-containing pro... 28 4.4 >At5g41830.1 68418.m05093 F-box family protein-related contains a novel domain similar to F-box that is shared among other proteins in Arabidopsis; similar to proteins At3g54160, At1g47920 (syntaxin SYP81), At3g44180, At1g56610, At3g58890, At1g48390, At3g59270 [Arabidopsis thaliana] Length = 463 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 152 YDIPPVKY-EYLDHTADVQLHAWGDSLKEA 238 +DIP + Y EYLD AD H DSL EA Sbjct: 207 FDIPNLVYLEYLDTIADKYQHVRFDSLVEA 236 >At2g32490.1 68415.m03970 3'-5' exonuclease domain-containing protein contains Pfam profile PF01612: 3'-5' exonuclease Length = 217 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 295 LDVLKLGHVTEHRHPALLEGFFKTV 221 LD+ +L H+ + HP LL F+T+ Sbjct: 138 LDIWRLVHIRHYLHPLLLSSSFETI 162 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,074,306 Number of Sequences: 28952 Number of extensions: 183442 Number of successful extensions: 392 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 386 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -