BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F06f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptid... 45 4e-05 At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type pept... 42 3e-04 At3g49510.1 68416.m05411 F-box family protein contains Pfam PF00... 32 0.20 At2g34880.1 68415.m04282 transcription factor jumonji (jmj) fami... 31 0.36 At3g16740.1 68416.m02137 F-box family protein contains F-box dom... 30 0.82 At1g20860.1 68414.m02613 phosphate transporter family protein si... 29 2.5 At1g76430.1 68414.m08885 phosphate transporter family protein si... 28 3.3 At3g24580.1 68416.m03088 F-box family protein contains F-box dom... 28 4.4 >At4g25340.1 68417.m03647 immunophilin-related / FKBP-type peptidyl-prolyl cis-trans isomerase-related immunophilin FKBP46 - Spodoptera frugiperda (fall armyworm),PIR2:A55320 Length = 477 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 4/93 (4%) Frame = +1 Query: 115 FWGLIMEPNK--RYTQVVEK-PFHISQAAMDTSTGDNEPCQVMVVVDGKNFLVCTLQKNK 285 FWGL ++P K Y E+ H++QA + T + + D +C+L NK Sbjct: 3 FWGLEVKPGKPQAYNPKNEQGKIHVTQATLGTGLSKEKSVIQCSIGDKAPIALCSLLPNK 62 Query: 286 CIQVPLDLYFKTGDS-IAFLTNGKCNVHLTGYL 381 PL+L F D + F G ++HL+G+L Sbjct: 63 IECCPLNLEFDDDDEPVEFTVTGDRSIHLSGFL 95 >At3g12340.1 68416.m01538 immunophilin, putative / FKBP-type peptidyl-prolyl cis-trans isomerase, putative contains Pfam profile: PF00254, FKBP-type peptidyl-prolyl cis-trans isomerases Length = 694 Score = 41.5 bits (93), Expect = 3e-04 Identities = 23/68 (33%), Positives = 32/68 (47%) Frame = +1 Query: 175 HISQAAMDTSTGDNEPCQVMVVVDGKNFLVCTLQKNKCIQVPLDLYFKTGDSIAFLTNGK 354 H+SQA + T N V + L+C L +K L+L F+ D + F G Sbjct: 223 HLSQATLGHGTATNRSILQCNVGNKSPLLLCVLTPDKVDSCQLNLEFEETDEVIFSVIGP 282 Query: 355 CNVHLTGY 378 +VHLTGY Sbjct: 283 RSVHLTGY 290 >At3g49510.1 68416.m05411 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 662 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +2 Query: 131 WNPTNGTPKWWRSRSTFHR 187 WNP G KW R R+TFHR Sbjct: 123 WNPYLGQTKWIRPRNTFHR 141 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 131 WNPTNGTPKWWRSRSTFHR 187 WNP KW R R+TFHR Sbjct: 392 WNPYLCQTKWIRLRNTFHR 410 >At2g34880.1 68415.m04282 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains Pfam domains, PF02375: jmjN domain, PF02373: jmjC domain and PF02928: C5HC2 zinc finger Length = 806 Score = 31.5 bits (68), Expect = 0.36 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -2 Query: 304 QVELECICFSGECTRESSFHQQQPSLDMAHYH 209 QV+ EC +GEC + S + +D+A YH Sbjct: 605 QVQEECFDLNGECNKSSEICEDASIMDLAAYH 636 >At3g16740.1 68416.m02137 F-box family protein contains F-box domain Pfam:PF00646 Length = 391 Score = 30.3 bits (65), Expect = 0.82 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +2 Query: 131 WNPTNGTPKWWRSRSTFHRL 190 WNP +G +W + R+++HRL Sbjct: 125 WNPYSGQTRWIKPRNSYHRL 144 >At1g20860.1 68414.m02613 phosphate transporter family protein similar to phosphate transporter [Catharanthus roseus] GI:2208908, inorganic phosphate transporter 1 [Solanum tuberosum] GI:1420871; contains Pfam profile PF00083: major facilitator superfamily protein Length = 534 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 73 VFLVIYASDLTINMFWGLIMEPNKRYTQVVEKPFHISQAAMD 198 + L+I A + +W ++M RYT +VE +I QAA D Sbjct: 205 LILMIGALPAALTFYWRMLMPETARYTALVEN--NIVQAAKD 244 >At1g76430.1 68414.m08885 phosphate transporter family protein similar to phosphate transporters from [Catharanthus roseus] GI:2208908 and [Nicotiana tabacum] GI:12641853, transmembrane protein [Solanum tuberosum] GI:17065936; contains Pfam profile: PF00083 major facilitator superfamily protein Length = 532 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 73 VFLVIYASDLTINMFWGLIMEPNKRYTQVVEKPFHISQAAMD 198 + L+I A + +W ++M RYT +VE ++ QAA D Sbjct: 213 LILMIGALPAALTFYWRMLMPETARYTALVEN--NVVQAAKD 252 >At3g24580.1 68416.m03088 F-box family protein contains F-box domain Pfam:PF00646 Length = 378 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +2 Query: 131 WNPTNGTPKWWRSRSTFHRL-LWTHQL 208 WNP G +W S + FH+L ++T+ L Sbjct: 127 WNPYWGQTRWIESTNNFHKLDMYTYAL 153 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,858,051 Number of Sequences: 28952 Number of extensions: 196254 Number of successful extensions: 459 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -