BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F05f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product... 29 1.4 At2g15535.1 68415.m01779 SLR1 binding pollen coat protein-relate... 29 1.9 At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein... 28 4.4 At1g22060.1 68414.m02759 expressed protein 28 4.4 At4g13990.1 68417.m02164 exostosin family protein contains Pfam ... 27 7.7 At1g32340.1 68414.m03985 zinc finger (C3HC4-type RING finger) fa... 27 7.7 >At2g20960.1 68415.m02479 expressed protein pEARLI 4 gene product [Arabidopsis thaliana] GI:871782 Length = 748 Score = 29.5 bits (63), Expect = 1.4 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 27 PEYQQQLPFRFQRGERQPSFCSQRPMPESKT--LRPTMSKESDRLP 158 P+ + P QR R P F + P P SKT +PT + S R P Sbjct: 286 PQTPETRPRTAQRRGRSPEFMERSPGPRSKTPEPQPTYFEPSSRTP 331 >At2g15535.1 68415.m01779 SLR1 binding pollen coat protein-related contains weak similarity to SLR1 binding pollen coat protein [Brassica juncea] gi|7649936|dbj|BAA94096 Length = 81 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = +1 Query: 151 DCPVICKESYDEFNICAS*KPKRCKKTKCGRTLP 252 DC +C + Y +IC + KP C C R P Sbjct: 46 DCKSLCHKKYKGGSICTTGKPNICMCLVCRRRSP 79 >At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein contains PF01422: NF-X1 type zinc finger Length = 912 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 40 NNYHSDFKEAKDSLRSALRDQCQKVKRCVLQCQKNQ 147 N+Y S F A D S+L + + ++C L+CQK + Sbjct: 607 NHYCSYFCHALDIRSSSLDKRSESCEKCDLRCQKER 642 >At1g22060.1 68414.m02759 expressed protein Length = 1999 Score = 27.9 bits (59), Expect = 4.4 Identities = 14/46 (30%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +3 Query: 96 RPMPESKTLRPTMSKESDRLPCY---LQRKLRRIQHLRIVEAKKMQ 224 R + ESK R +++K+ D++ CY L ++L Q +VE + ++ Sbjct: 519 RGLDESKAERDSLTKKMDQMECYYESLVQELEETQRQLLVELQSLR 564 >At4g13990.1 68417.m02164 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 521 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = +1 Query: 64 EAKDSLRSALRDQC-QKVKRC-VLQCQKNQIDC 156 E KDS+R + D+C + K+C +L C ++C Sbjct: 321 EYKDSVRGKIIDECLESKKQCYLLDCNYGNVNC 353 >At1g32340.1 68414.m03985 zinc finger (C3HC4-type RING finger) family protein contains a Zinc finger, C3HC4 type (RING finger) signature, PROSITE:PS00518 Length = 688 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 166 CKESYDEFNICAS*KPK-RCKKTKCGRTLPPNWL 264 C ++Y + ++ K +C +KCG T+PP L Sbjct: 403 CMKTYTDIHVTEGTVNKLKCPDSKCGETVPPGIL 436 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,027,786 Number of Sequences: 28952 Number of extensions: 221942 Number of successful extensions: 609 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 601 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 609 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -