BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F01f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 4e-10 SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) 61 6e-10 SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) 61 6e-10 SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) 61 6e-10 SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) 61 6e-10 SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) 61 6e-10 SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) 61 6e-10 SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) 61 6e-10 SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) 61 6e-10 SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) 45 3e-05 SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) 40 0.001 SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) 34 0.062 SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_35943| Best HMM Match : MFS_1 (HMM E-Value=1.5e-05) 29 2.3 SB_15823| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_5047| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.18) 27 9.4 >SB_41057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 296 Score = 61.7 bits (143), Expect = 4e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA*ISLI 421 NLCAIHAKRVTIMPKDIQLARRIRGERA +L+ Sbjct: 59 NLCAIHAKRVTIMPKDIQLARRIRGERAMSTLV 91 >SB_55955| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_55460| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_53830| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_51993| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_48637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_47751| Best HMM Match : Histone (HMM E-Value=4.3e-07) Length = 55 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 28 NLCAIHAKRVTIMPKDIQLARRIRGERA 55 >SB_44589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_35355| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 67 NLCAIHAKRVTIMPKDIQLARRIRGERA 94 >SB_30057| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 260 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 233 NLCAIHAKRVTIMPKDIQLARRIRGERA 260 >SB_21880| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_21745| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 19 NLCAIHAKRVTIMPKDIQLARRIRGERA 46 >SB_20370| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_18391| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_17374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_13453| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_11407| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 19 NLCAIHAKRVTIMPKDIQLARRIRGERA 46 >SB_8948| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_4426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_3841| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_59571| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_58125| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_57761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_56157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_55483| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_54709| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_53175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_51431| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_49908| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_48866| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 205 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 178 NLCAIHAKRVTIMPKDIQLARRIRGERA 205 >SB_48698| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_47677| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_45363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_43396| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 131 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 104 NLCAIHAKRVTIMPKDIQLARRIRGERA 131 >SB_39847| Best HMM Match : Histone (HMM E-Value=1.3e-07) Length = 407 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 380 NLCAIHAKRVTIMPKDIQLARRIRGERA 407 >SB_38339| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_33151| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_32791| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 94 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 67 NLCAIHAKRVTIMPKDIQLARRIRGERA 94 >SB_27350| Best HMM Match : Histone (HMM E-Value=1.1e-08) Length = 46 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 19 NLCAIHAKRVTIMPKDIQLARRIRGERA 46 >SB_25703| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_19242| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_18626| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_17756| Best HMM Match : Histone (HMM E-Value=8.5e-41) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_13396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_11832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 493 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_7960| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_7640| Best HMM Match : Histone (HMM E-Value=4.80001e-41) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_4579| Best HMM Match : Histone (HMM E-Value=5.29971e-42) Length = 136 Score = 60.9 bits (141), Expect = 6e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >SB_10761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 49.6 bits (113), Expect = 2e-06 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRG 445 NLCAIHAKRVTIMPKD+ LA RIRG Sbjct: 147 NLCAIHAKRVTIMPKDLHLALRIRG 171 >SB_55375| Best HMM Match : Histone (HMM E-Value=9.2e-35) Length = 136 Score = 45.2 bits (102), Expect = 3e-05 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLA 460 NLCAIHAKRVTIMPKDIQLA Sbjct: 109 NLCAIHAKRVTIMPKDIQLA 128 >SB_14746| Best HMM Match : Histone (HMM E-Value=4.4e-32) Length = 162 Score = 40.3 bits (90), Expect = 0.001 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQ 466 NLCAIHAKRVTIMPKDI+ Sbjct: 109 NLCAIHAKRVTIMPKDIR 126 >SB_5701| Best HMM Match : Linker_histone (HMM E-Value=5.9e-39) Length = 370 Score = 34.3 bits (75), Expect = 0.062 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPK 475 NLCAIHAKRVTIMP+ Sbjct: 109 NLCAIHAKRVTIMPQ 123 >SB_5300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 29.5 bits (63), Expect = 1.8 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 519 NLCAIHAKRVTIMPK 475 NLCAIHAKRVT+ K Sbjct: 106 NLCAIHAKRVTLCQK 120 >SB_35943| Best HMM Match : MFS_1 (HMM E-Value=1.5e-05) Length = 514 Score = 29.1 bits (62), Expect = 2.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 138 NLQSHLTQIRHPWAFSVTNEPYTILHDHI 224 ++Q H + PWA + +EP T LHD++ Sbjct: 179 SIQDH-GNLPRPWALQLMDEPVTSLHDNV 206 >SB_15823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 637 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/37 (29%), Positives = 17/37 (45%) Frame = +3 Query: 87 SHACVAWKYYLITTARHNLQSHLTQIRHPWAFSVTNE 197 +H C W+ L T +N H T +R P + T + Sbjct: 205 NHDCEGWRRVLSTQCENNGLFHTTSLRRPKGVAATTK 241 >SB_5047| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.18) Length = 297 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/45 (31%), Positives = 21/45 (46%) Frame = +2 Query: 38 TPNTQLHIMNQFKHRLLTRMCGLEILPNNYC*TQLTKSFNTDQAS 172 TP Q H + H +++ GL+ PN ++FNT AS Sbjct: 194 TPRKQSHDSSDTSHATNSKIDGLKTTPNGVIPDSKEETFNTSIAS 238 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,682,763 Number of Sequences: 59808 Number of extensions: 227989 Number of successful extensions: 432 Number of sequences better than 10.0: 56 Number of HSP's better than 10.0 without gapping: 388 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 431 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -