BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312F01f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65360.1 68418.m08221 histone H3 identical to histone H3 from... 61 5e-10 At5g10980.1 68418.m01277 histone H3 identical to HISTONE H3.2, M... 61 5e-10 At5g10400.1 68418.m01206 histone H3 identical to several histone... 61 5e-10 At5g10390.1 68418.m01205 histone H3 identical to histone H3 from... 61 5e-10 At4g40040.1 68417.m05668 histone H3.2 identical to Histone H3.2,... 61 5e-10 At4g40030.1 68417.m05667 histone H3.2 identical to Histone H3.2,... 61 5e-10 At3g27360.1 68416.m03421 histone H3 identical to histone H3 from... 61 5e-10 At1g09200.1 68414.m01027 histone H3 identical to histone H3 from... 61 5e-10 At1g75600.1 68414.m08784 histone H3.2, putative strong similarit... 60 7e-10 At5g65350.1 68418.m08220 histone H3 nearly identical to histone ... 59 2e-09 At1g13370.1 68414.m01554 histone H3, putative strong similarity ... 58 4e-09 At1g19890.1 68414.m02494 histone H3, putative similar to histone... 58 5e-09 At5g12910.1 68418.m01481 histone H3, putative similar to histone... 52 2e-07 At1g01370.1 68414.m00052 centromeric histone H3 HTR12 (HTR12) si... 41 4e-04 At5g61350.1 68418.m07698 protein kinase family protein contains ... 27 7.7 >At5g65360.1 68418.m08221 histone H3 identical to histone H3 from Zea mays SP|P05203, Medicago sativa GI:166384, Encephalartos altensteinii SP|P08903, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At5g10980.1 68418.m01277 histone H3 identical to HISTONE H3.2, MINOR, Medicago sativa, SWISSPROT:P11105, histone H3 variant H3.3 Lycopersicon esculentum GI:1435157; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At5g10400.1 68418.m01206 histone H3 identical to several histone H3 proteins, including Zea mays SP|P05203, Medicago sativa GI:166384, Encephalartos altensteinii SP|P08903, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At5g10390.1 68418.m01205 histone H3 identical to histone H3 from Zea mays SP|P05203, Medicago sativa GI:166384, Encephalartos altensteinii SP|P08903, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At4g40040.1 68417.m05668 histone H3.2 identical to Histone H3.2, minor Lolium temulentum SP|P11105, nearly identical to histone H3.2 Mus pahari GI:515005; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At4g40030.1 68417.m05667 histone H3.2 identical to Histone H3.2, minor Lolium temulentum SP|P11105, nearly identical to histone H3.2 Mus pahari GI:515005; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At3g27360.1 68416.m03421 histone H3 identical to histone H3 from Zea mays SP|P05203, Medicago sativa GI:166384, Encephalartos altensteinii SP|P08903, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At1g09200.1 68414.m01027 histone H3 identical to histone H3 from Zea mays SP|P05203, Medicago sativa GI:166384, Encephalartos altensteinii SP|P08903, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.9 bits (141), Expect = 5e-10 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKDIQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDIQLARRIRGERA 136 >At1g75600.1 68414.m08784 histone H3.2, putative strong similarity to histone H3.2 SP|P11105 GI:417103 from Lolium temulentum, histone H3.2 from Mus pahari GI:515005; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 60.5 bits (140), Expect = 7e-10 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKD+QLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKDVQLARRIRGERA 136 >At5g65350.1 68418.m08220 histone H3 nearly identical to histone H3 from Zea mays SP|P05203, Medicago sativa GI:166384, Encephalartos altensteinii SP|P08903, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 139 Score = 59.3 bits (137), Expect = 2e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPK+IQLARRIRGERA Sbjct: 109 NLCAIHAKRVTIMPKEIQLARRIRGERA 136 >At1g13370.1 68414.m01554 histone H3, putative strong similarity to Histone H3.2, minor Medicago sativa SP|P11105, histone H3 Rubus idaeus GI:10732809; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 136 Score = 58.0 bits (134), Expect = 4e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIMPKD+QLARRIR ERA Sbjct: 109 NLCAIHAKRVTIMPKDVQLARRIRAERA 136 >At1g19890.1 68414.m02494 histone H3, putative similar to histone H3 from Chlamydomonas reinhardtii GI:571470, Volvox carteri SP|P08437, histone H3.2 minor from Lolium temulentum SP|P11105; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 137 Score = 57.6 bits (133), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGERA 436 NLCAIHAKRVTIM KDIQLARRIRGERA Sbjct: 110 NLCAIHAKRVTIMSKDIQLARRIRGERA 137 >At5g12910.1 68418.m01481 histone H3, putative similar to histone H3 from Mus musculus GI:51301, Gallus gallus GI:211859, Medicago sativa GI:166384, Pisum sativum SP|P02300; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 131 Score = 52.4 bits (120), Expect = 2e-07 Identities = 22/27 (81%), Positives = 26/27 (96%) Frame = -3 Query: 519 NLCAIHAKRVTIMPKDIQLARRIRGER 439 NLCA+HAKR TIMPKDIQLA+R+RG+R Sbjct: 104 NLCAMHAKRSTIMPKDIQLAKRLRGDR 130 >At1g01370.1 68414.m00052 centromeric histone H3 HTR12 (HTR12) similar to histone H3 GB:X17141 GI:10795 from Tetrahymena pyriformis, GI:161790 from Tetrahymena thermophila; contains Pfam profile PF00125 Core histone H2A/H2B/H3/H4 Length = 178 Score = 41.1 bits (92), Expect = 4e-04 Identities = 17/25 (68%), Positives = 22/25 (88%) Frame = -3 Query: 516 LCAIHAKRVTIMPKDIQLARRIRGE 442 LCAIHA+RVT+M KD +LARR+ G+ Sbjct: 150 LCAIHARRVTLMRKDFELARRLGGK 174 >At5g61350.1 68418.m07698 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 842 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/44 (29%), Positives = 21/44 (47%), Gaps = 6/44 (13%) Frame = +3 Query: 105 WKYYLITTARHNLQSHLTQIRHPW------AFSVTNEPYTILHD 218 + +Y+ RH ++ H + HP FSVT + +LHD Sbjct: 100 YSFYISRPGRHWIRLHFYPLNHPLYNLTNSVFSVTTDTTVLLHD 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,549,449 Number of Sequences: 28952 Number of extensions: 159871 Number of successful extensions: 242 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 242 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -