BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E12f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46920.1 68416.m05092 protein kinase family protein similar t... 29 2.5 At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01... 27 5.8 >At3g46920.1 68416.m05092 protein kinase family protein similar to MAP3K delta-1 protein kinase [Arabidopsis thaliana] GI:2253010; contains Pfam profile: PF00069 Eukaryotic protein kinase domain Length = 1171 Score = 28.7 bits (61), Expect = 2.5 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -2 Query: 220 DYVSLPDNITANIDIDGHXXXXXXXXXLDDPWNLGENSHSELE 92 D +LP ++++++ H DPWNL NS+ +++ Sbjct: 729 DAANLPSSLSSSVGGADHKESSKSLFSNQDPWNLQTNSNEDVK 771 >At1g20970.1 68414.m02625 adhesin-related contains TIGRFAM TIGR01612: reticulocyte binding protein; contains TIGRFAM TIGR00864: polycystin cation channel protein; similar to fimbriae-associated protein Fap1 [Streptococcus parasanguinis] (GI:3929312) Length = 1498 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 466 DNQFPNNDEFIPYVTAGNLASKNGAKVTLWGKVTRVSASEGFYV 335 +NQ D + +GN+ + KV G+V+ + ASEG V Sbjct: 764 ENQKDGVDSIYKLLCSGNVVDRTDDKVASTGEVSVLDASEGLTV 807 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,061,094 Number of Sequences: 28952 Number of extensions: 183489 Number of successful extensions: 461 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -