BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E09f (521 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY094671-1|AAM11024.1| 1297|Drosophila melanogaster GH03947p pro... 29 3.8 AE013599-1327|AAF58636.1| 1297|Drosophila melanogaster CG9005-PA... 29 3.8 BT029727-1|ABL75784.1| 288|Drosophila melanogaster IP17596p pro... 29 5.1 >AY094671-1|AAM11024.1| 1297|Drosophila melanogaster GH03947p protein. Length = 1297 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -3 Query: 228 IKQHVTTSTNAQRGTRQRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPR 79 IKQH TT++N+ G Q DG A+ N NV + V + PR Sbjct: 467 IKQHTTTNSNS--GLHQEDGFSAKANVHNFPNVNVSESYSISVSVRSLPR 514 >AE013599-1327|AAF58636.1| 1297|Drosophila melanogaster CG9005-PA protein. Length = 1297 Score = 29.1 bits (62), Expect = 3.8 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = -3 Query: 228 IKQHVTTSTNAQRGTRQRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPR 79 IKQH TT++N+ G Q DG A+ N NV + V + PR Sbjct: 467 IKQHTTTNSNS--GLHQEDGFSAKANVHNFPNVNVSESYSISVSVRSLPR 514 >BT029727-1|ABL75784.1| 288|Drosophila melanogaster IP17596p protein. Length = 288 Score = 28.7 bits (61), Expect = 5.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 85 STDRNVRSKCRCSNVSCSSHYDAQLTA 5 S + N+ + C C+N+SCSS +T+ Sbjct: 87 SNNSNIVTNCSCNNISCSSSNTQPITS 113 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,368,652 Number of Sequences: 53049 Number of extensions: 350650 Number of successful extensions: 994 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 964 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 992 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -