BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312E05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 25 1.5 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 4.7 AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A... 23 6.2 DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted ... 23 8.2 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 25.0 bits (52), Expect = 1.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 97 NTT*NYYIRWRKLHQSCSFS*NLRKNANFIFQN 195 N + N+ + WR +H+SC S L+++ F+ N Sbjct: 935 NPSVNWRLLWRNIHRSCLSS--LQRSTLFLLVN 965 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/37 (27%), Positives = 21/37 (56%) Frame = +3 Query: 270 DLRYN*TNRQYE*TNKLLTIYTNNKIXXTSKVRLRLN 380 ++ N N QY+ +NK L ++N ++ ++ +LN Sbjct: 355 EIENNIGNLQYQLSNKFLANFSNMRLKKINRGNRKLN 391 >AF000953-1|AAB96576.1| 433|Anopheles gambiae carboxypeptidase A protein. Length = 433 Score = 23.0 bits (47), Expect = 6.2 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +2 Query: 455 RNWDFYW 475 RNWDF+W Sbjct: 260 RNWDFHW 266 >DQ518577-1|ABF66619.1| 318|Anopheles gambiae putative secreted carbonic anhydrase protein. Length = 318 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 121 RWRKLHQSCS 150 RW K HQSC+ Sbjct: 44 RWSKAHQSCA 53 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 378,185 Number of Sequences: 2352 Number of extensions: 5606 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -