BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312D08f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g10430.1 68416.m01251 F-box family protein contains F-box dom... 36 0.012 At3g08750.1 68416.m01017 F-box family protein contains F-box dom... 31 0.62 At4g04690.1 68417.m00685 F-box family protein (FBX15) contains F... 30 0.82 At1g51550.1 68414.m05802 F-box family protein similar to F-box Z... 30 0.82 At3g56690.1 68416.m06306 calmodulin-binding protein identical to... 29 1.4 At5g39450.1 68418.m04778 F-box family protein contains Pfam:PF00... 29 1.9 At3g13820.1 68416.m01745 F-box family protein contains Pfam PF00... 29 2.5 At3g18330.1 68416.m02332 F-box family protein contains Pfam PF00... 28 3.3 At4g15230.1 68417.m02333 ABC transporter family protein similar ... 27 5.8 At4g15215.1 68417.m02332 ABC transporter family protein similar ... 27 5.8 At1g09650.1 68414.m01083 F-box family protein contains Pfam PF00... 27 5.8 At5g36200.1 68418.m04364 F-box family protein contains Pfam PF00... 27 7.7 At2g17020.1 68415.m01962 F-box family protein (FBL10) contains s... 27 7.7 At1g66940.2 68414.m07609 protein kinase-related 27 7.7 At1g66940.1 68414.m07608 protein kinase-related 27 7.7 >At3g10430.1 68416.m01251 F-box family protein contains F-box domain Pfam:PF00646 Length = 370 Score = 36.3 bits (80), Expect = 0.012 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = +3 Query: 114 SLPAEVISIILKNNDCQEILNFSSTCKHFNELVNTDQQLWKEKL 245 SLP ++I IL+ + +L F STCK + EL++ D++ + L Sbjct: 4 SLPFDLILEILQRTPAESLLRFKSTCKKWYELISNDKRFMYKHL 47 >At3g08750.1 68416.m01017 F-box family protein contains F-box domain Pfam:PF00646 Length = 369 Score = 30.7 bits (66), Expect = 0.62 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 102 LSIYSLPAEVISIILKNNDCQEILNFSSTCKHFNELVNTDQQLWKEKLKELIPD 263 L + SLP E+I IL + ++ F STCK + L+ T+++ L P+ Sbjct: 7 LLLPSLPFELIEEILYKIPAESLIRFKSTCKKWYNLI-TEKRFMYNHLDHYSPE 59 >At4g04690.1 68417.m00685 F-box family protein (FBX15) contains F-box domain PF:00646 Length = 378 Score = 30.3 bits (65), Expect = 0.82 Identities = 12/40 (30%), Positives = 23/40 (57%) Frame = +3 Query: 114 SLPAEVISIILKNNDCQEILNFSSTCKHFNELVNTDQQLW 233 SLP E++ ILK + + F STCK + ++ + + ++ Sbjct: 10 SLPFELVEEILKKTPAESLNRFKSTCKQWYGIITSKRFMY 49 >At1g51550.1 68414.m05802 F-box family protein similar to F-box ZEITLUPE/FKF/LKP/ADAGIO proteins e.g. GI:13487068 from [Arabidopsis thaliana] Length = 478 Score = 30.3 bits (65), Expect = 0.82 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +3 Query: 108 IYSLPAEVISIILKNNDCQEILNFSSTCKHFNELVNTDQQLWKEKL-KELIPDAAFVVVE 284 I +LP + + IL IL+FS TCK + L +D LW+ +E P + + Sbjct: 21 IINLPDDHLLTILLLLPVDSILSFSMTCKRYKSLACSD-SLWEALCEREWGPTSVDALKL 79 Query: 285 SDCHDG-DWL 311 S DG W+ Sbjct: 80 SSLRDGFSWM 89 >At3g56690.1 68416.m06306 calmodulin-binding protein identical to calmodulin-binding protein GI:6760428 from [Arabidopsis thaliana] Length = 1022 Score = 29.5 bits (63), Expect = 1.4 Identities = 18/78 (23%), Positives = 37/78 (47%) Frame = +3 Query: 6 LYNLLAVTSGWSSKSITTTS*DLRKIHIMDEELSIYSLPAEVISIILKNNDCQEILNFSS 185 L L ++T G++ I+ + I ++E L + + + + + EIL++ + Sbjct: 918 LKELASITKGYTGADISLICREAA-IAALEESLEMEEISMRHLKAAISQIEPTEILSYKA 976 Query: 186 TCKHFNELVNTDQQLWKE 239 + F LV+TD Q +E Sbjct: 977 LSEKFQRLVHTDPQREEE 994 >At5g39450.1 68418.m04778 F-box family protein contains Pfam:PF00646 F-box domain ; similar to SKP1 interacting partner 2 (SKIP2) TIGR_Ath1:At5g67250 Length = 579 Score = 29.1 bits (62), Expect = 1.9 Identities = 13/42 (30%), Positives = 27/42 (64%) Frame = +3 Query: 108 IYSLPAEVISIILKNNDCQEILNFSSTCKHFNELVNTDQQLW 233 + SLP +VI++I + ++I N S CK ++V++ +++W Sbjct: 19 LLSLPEDVIAVIARFVSPRDICNLSLCCKSLCDVVDS-ERIW 59 >At3g13820.1 68416.m01745 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 415 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 114 SLPAEVISIILKNNDCQEILNFSSTCKHFNEL 209 +LPAEV+ IL + STCK +N L Sbjct: 6 NLPAEVLEEILSRTPVTSLRTMRSTCKKWNNL 37 >At3g18330.1 68416.m02332 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain Length = 376 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 114 SLPAEVISIILKNNDCQEILNFSSTCKHFNELVNTDQQ 227 +LP E++ IL + S+TCK +N L++ D++ Sbjct: 5 NLPKELVEEILSFVPATYLKRLSATCKPWNRLIHNDKR 42 >At4g15230.1 68417.m02333 ABC transporter family protein similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1326 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/37 (35%), Positives = 24/37 (64%), Gaps = 1/37 (2%) Frame = +3 Query: 162 QEILNFSSTCKHFNELVNTDQQLWK-EKLKELIPDAA 269 +E L+FS+ C+ + +++ + EKL+E+IPD A Sbjct: 233 RETLDFSACCQGIGSRMEIMKEISRMEKLQEIIPDPA 269 >At4g15215.1 68417.m02332 ABC transporter family protein similar to PDR5-like ABC transporter [Spirodela polyrhiza] GI:1514643; contains Pfam profile PF00005: ABC transporter Length = 1390 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 162 QEILNFSSTCKHFNELVNTDQQLWK-EKLKELIPD 263 +E L+FS+ C+ + +++ + EKLKE++PD Sbjct: 230 RETLDFSACCQGIGSRMEIMKEISRREKLKEIVPD 264 >At1g09650.1 68414.m01083 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 382 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +3 Query: 102 LSIYSLPAEVISIILKNNDCQEILNFSSTCKHFNELVNT 218 L + SLP EV+ IL+ D +L F + K + + + Sbjct: 8 LMMESLPHEVVECILERLDADPLLRFKAVSKQWKSTIES 46 >At5g36200.1 68418.m04364 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640: F-box protein interaction domain; similar to unknown protein (pir||T00841) Length = 471 Score = 27.1 bits (57), Expect = 7.7 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 102 LSIYSLPAEVISIILKNNDCQEILNFSSTCKHFNELVN 215 +++ LP +++ I+ + I SSTCK++N L N Sbjct: 1 MAMSDLPNDLVEEIISRVPVKSIRAVSSTCKNWNTLSN 38 >At2g17020.1 68415.m01962 F-box family protein (FBL10) contains similarity to F-box protein Partner of Paired GI:10441427 from [Drosophila melanogaster] Length = 656 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +3 Query: 93 DEELSIYSLPAEVISIILKNNDCQEILNFSSTCKHFNELV 212 D E S+ LPA ++ I+ D + + +STCK V Sbjct: 18 DGERSLDLLPAALLETIMTKLDVASLCSLASTCKTLKSCV 57 >At1g66940.2 68414.m07609 protein kinase-related Length = 309 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 132 ISIILKNNDCQEILNFSSTCKHFNE 206 +++++ N CQE L+ C FNE Sbjct: 199 VTVVINENTCQECLSSLGRCHVFNE 223 >At1g66940.1 68414.m07608 protein kinase-related Length = 332 Score = 27.1 bits (57), Expect = 7.7 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 132 ISIILKNNDCQEILNFSSTCKHFNE 206 +++++ N CQE L+ C FNE Sbjct: 199 VTVVINENTCQECLSSLGRCHVFNE 223 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,974,429 Number of Sequences: 28952 Number of extensions: 177254 Number of successful extensions: 430 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 430 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -