BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312D04f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 123 6e-29 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 54 4e-08 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 51 5e-07 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 48 3e-06 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 48 4e-06 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 48 4e-06 At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing ... 47 9e-06 At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33... 45 3e-05 At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL3... 45 4e-05 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 45 4e-05 At1g16610.2 68414.m01990 arginine/serine-rich protein, putative ... 44 8e-05 At1g16610.1 68414.m01989 arginine/serine-rich protein, putative ... 44 8e-05 At5g51300.2 68418.m06360 splicing factor-related contains simila... 42 3e-04 At5g51300.1 68418.m06359 splicing factor-related contains simila... 42 3e-04 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 41 4e-04 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 41 4e-04 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 41 4e-04 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 41 4e-04 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 41 4e-04 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 40 8e-04 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 40 8e-04 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 40 8e-04 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 40 0.001 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 40 0.001 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 40 0.001 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 40 0.001 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 40 0.001 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 39 0.002 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 39 0.002 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 39 0.002 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 39 0.002 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 38 0.003 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 38 0.003 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 38 0.004 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 38 0.004 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 38 0.004 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 38 0.005 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 38 0.005 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 38 0.005 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 37 0.007 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 37 0.009 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 37 0.009 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 37 0.009 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 37 0.009 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 37 0.009 At5g59950.3 68418.m07518 RNA and export factor-binding protein, ... 36 0.012 At5g59950.2 68418.m07519 RNA and export factor-binding protein, ... 36 0.012 At5g59950.1 68418.m07517 RNA and export factor-binding protein, ... 36 0.012 At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28... 36 0.012 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 36 0.012 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 36 0.017 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 36 0.017 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 36 0.017 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 36 0.017 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 36 0.017 At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, pu... 36 0.017 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 36 0.017 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.017 At5g02530.1 68418.m00187 RNA and export factor-binding protein, ... 36 0.022 At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing ... 36 0.022 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 36 0.022 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 36 0.022 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 36 0.022 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 36 0.022 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 36 0.022 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 35 0.029 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 35 0.029 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 35 0.029 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 35 0.029 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 35 0.029 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 35 0.038 At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing ... 35 0.038 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 35 0.038 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 35 0.038 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 35 0.038 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 35 0.038 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 35 0.038 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 34 0.050 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 34 0.050 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 34 0.050 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 34 0.050 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 34 0.050 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 34 0.050 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 34 0.067 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 34 0.067 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 33 0.088 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 33 0.088 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 33 0.088 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 33 0.088 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 33 0.088 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 33 0.088 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 33 0.12 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 33 0.12 At3g12480.1 68416.m01553 transcription factor, putative 33 0.12 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 33 0.12 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 33 0.12 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 33 0.12 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 33 0.12 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 33 0.12 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 33 0.12 At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing ... 33 0.15 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 33 0.15 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 33 0.15 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 33 0.15 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 33 0.15 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 33 0.15 At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) simila... 33 0.15 At1g58983.1 68414.m06666 40S ribosomal protein S2, putative simi... 33 0.15 At1g58684.1 68414.m06657 40S ribosomal protein S2, putative 33 0.15 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 32 0.20 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 32 0.20 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 32 0.20 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 32 0.20 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 32 0.20 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 32 0.20 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 32 0.20 At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi do... 32 0.20 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 32 0.27 At5g41690.1 68418.m05067 polyadenylate-binding protein, putative... 32 0.27 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 32 0.27 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 32 0.27 At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) simila... 32 0.27 At1g45100.1 68414.m05170 polyadenylate-binding protein, putative... 32 0.27 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 32 0.27 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 32 0.27 At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein ... 32 0.27 At5g37720.1 68418.m04541 RNA and export factor-binding protein, ... 31 0.36 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 31 0.36 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 31 0.36 At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing ... 31 0.36 At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing ... 31 0.36 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 31 0.36 At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein ... 31 0.36 At1g05890.1 68414.m00617 zinc finger protein-related contains lo... 31 0.36 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 31 0.36 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 31 0.47 At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing ... 31 0.47 At4g26110.1 68417.m03759 nucleosome assembly protein (NAP), puta... 31 0.47 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 31 0.47 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 31 0.47 At3g47820.1 68416.m05211 armadillo/beta-catenin repeat family pr... 31 0.47 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 31 0.47 At1g66260.1 68414.m07522 RNA and export factor-binding protein, ... 31 0.47 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 31 0.62 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 31 0.62 At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) 31 0.62 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 30 0.82 At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ri... 30 0.82 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 30 0.82 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 30 1.1 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 30 1.1 At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADNE... 30 1.1 At5g37055.1 68418.m04446 zinc finger (HIT type) family protein c... 29 1.4 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 29 1.4 At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing ... 29 1.4 At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein ... 29 1.9 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 29 1.9 At2g28910.1 68415.m03513 CAX-interacting protein 4 (CAXIP4) cont... 29 1.9 At1g09890.1 68414.m01113 expressed protein ; expression supporte... 29 1.9 At5g48650.1 68418.m06016 nuclear transport factor 2 (NTF2) famil... 29 2.5 At2g09910.1 68415.m01029 hypothetical protein 29 2.5 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 29 2.5 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 3.3 At2g34920.1 68415.m04287 ubiquitin-protein ligase-related contai... 28 3.3 At1g20760.1 68414.m02600 calcium-binding EF hand family protein ... 28 3.3 At5g64670.1 68418.m08127 ribosomal protein L15 family protein 28 4.4 At5g60030.1 68418.m07527 expressed protein 28 4.4 At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing ... 28 4.4 At4g20730.1 68417.m03013 filament protein-related similar to Cyt... 28 4.4 At2g30100.1 68415.m03663 ubiquitin family protein low similarity... 28 4.4 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 28 4.4 At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing ... 28 4.4 At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing ... 28 4.4 At5g63180.1 68418.m07932 pectate lyase family protein similar to... 27 5.8 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 27 5.8 At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing pro... 27 5.8 At3g62490.1 68416.m07021 expressed protein hypothetical proteins... 27 5.8 At3g61040.2 68416.m06831 cytochrome P450 family protein similar ... 27 5.8 At3g61040.1 68416.m06830 cytochrome P450 family protein similar ... 27 5.8 At2g17740.1 68415.m02055 DC1 domain-containing protein 27 5.8 At1g20220.1 68414.m02525 expressed protein 27 5.8 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 27 7.7 At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / E... 27 7.7 At5g08660.1 68418.m01031 expressed protein contains Pfam domain ... 27 7.7 At3g27700.2 68416.m03459 RNA recognition motif (RRM)-containing ... 27 7.7 At3g27700.1 68416.m03458 RNA recognition motif (RRM)-containing ... 27 7.7 At1g79100.1 68414.m09223 arginine/serine-rich protein-related si... 27 7.7 At1g15830.1 68414.m01900 expressed protein 27 7.7 At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) famil... 27 7.7 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 123 bits (297), Expect = 6e-29 Identities = 67/132 (50%), Positives = 82/132 (62%), Gaps = 8/132 (6%) Frame = +2 Query: 146 DVLDIENSEEFEVDEDGEQGIARLK--------EKARKRKGRGFGNEAGGGSAAERGNRG 301 D++D E + D G RLK E A+K KGRGF E +R Sbjct: 17 DLMDEEGTAIDGADVSPRAGHPRLKSAIAGANGESAKKTKGRGFREEKDSDRQRRLSSRD 76 Query: 302 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 481 ++SL G G PGPQRSVEGWI+ VS VHEE QEEDI N F +FGEIKN++LNLDRR+ Sbjct: 77 -FESL---GSDGRPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRS 132 Query: 482 GFLKGYALVEYE 517 G++KGYAL+EYE Sbjct: 133 GYVKGYALIEYE 144 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 54.4 bits (125), Expect = 4e-08 Identities = 24/76 (31%), Positives = 42/76 (55%) Frame = +2 Query: 293 NRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD 472 N R+ L+P+ +S TP ++ LFVS + + E ++ F++FGE+ + + D Sbjct: 31 NASRFSFLSPQAESQTPARPQAEPSTNLFVSGLSKRTTSEGLRTAFAQFGEVADAKVVTD 90 Query: 473 RRTGFLKGYALVEYET 520 R +G+ KG+ V Y T Sbjct: 91 RVSGYSKGFGFVRYAT 106 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 50.8 bits (116), Expect = 5e-07 Identities = 37/103 (35%), Positives = 49/103 (47%), Gaps = 5/103 (4%) Frame = +2 Query: 221 EKARKRKGRGF-GNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHE 397 +KA + GR G E A ERG RG + P+ + G E I FV Sbjct: 352 QKALEFHGRPLLGREIRLDIAQERGERGERPAFTPQSGNFRSGGDGGDEKKI-FVKGFDA 410 Query: 398 EAQEEDIQN----QFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 E+DI+N FS GEIKN+ + +DR TG KG A +E+ Sbjct: 411 SLSEDDIKNTLREHFSSCGEIKNVSVPIDRDTGNSKGIAYLEF 453 Score = 36.7 bits (81), Expect = 0.009 Identities = 16/59 (27%), Positives = 30/59 (50%) Frame = +2 Query: 338 TPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 TP + LF +N+ + D++N F E GE+ ++ + +R G +G+ VE+ Sbjct: 287 TPSTPAAGGSKTLFAANLSFNIERADVENFFKEAGEVVDVRFSTNRDDGSFRGFGHVEF 345 Score = 28.3 bits (60), Expect = 3.3 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +2 Query: 242 GRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPG 346 GRG G GG G RGR+ S G G G Sbjct: 492 GRGNGRFGSGGGRGRDGGRGRFGSGGGRGRDGGRG 526 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 48.4 bits (110), Expect = 3e-06 Identities = 21/47 (44%), Positives = 30/47 (63%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFVS ++ E+ E I+ +F +G IK +HL D+ T KGYA +EY Sbjct: 140 LFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 48.0 bits (109), Expect = 4e-06 Identities = 27/90 (30%), Positives = 44/90 (48%) Frame = +2 Query: 239 KGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDI 418 +G G+G+E GGG ++R G S SG+ S G L+V N+ + + Sbjct: 206 RGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMAL 265 Query: 419 QNQFSEFGEIKNIHLNLDRRTGFLKGYALV 508 +N F+E G++ + DR +G KG+ V Sbjct: 266 ENLFNEQGKVVEARVIYDRDSGRSKGFGFV 295 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 48.0 bits (109), Expect = 4e-06 Identities = 27/90 (30%), Positives = 44/90 (48%) Frame = +2 Query: 239 KGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDI 418 +G G+G+E GGG ++R G S SG+ S G L+V N+ + + Sbjct: 214 RGGGYGSERGGGYGSQRSGGGYGGSQRSSYGSGSGSGSGSGSGNRLYVGNLSWGVDDMAL 273 Query: 419 QNQFSEFGEIKNIHLNLDRRTGFLKGYALV 508 +N F+E G++ + DR +G KG+ V Sbjct: 274 ENLFNEQGKVVEARVIYDRDSGRSKGFGFV 303 >At4g19610.1 68417.m02881 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 783 Score = 46.8 bits (106), Expect = 9e-06 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 5/131 (3%) Frame = +2 Query: 137 NMADVLDIENSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSL 316 N++D SE+ DE G+ + + + R F + G A G D++ Sbjct: 181 NLSDSESDNESEDSSEDEAGDDD-GKAETDGQDADIRYFPID-GDVEAGGVGKDDDGDAM 238 Query: 317 APEGDSGTPGPQRSVEGWIL-----FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 481 EGD ++V +L FV N+ A EE++ FS FG+I +HL LD+ T Sbjct: 239 EVEGDGKVAQESKAVSDDVLDTGRLFVRNLPYTATEEELMEHFSTFGKISEVHLVLDKET 298 Query: 482 GFLKGYALVEY 514 +G A + Y Sbjct: 299 KRSRGIAYILY 309 >At1g55310.1 68414.m06318 SC35-like splicing factor, 33 kD (SCL33) nearly identical to SC35-like splicing factor SCL33, 33 kD [Arabidopsis thaliana] GI:9843659 Length = 220 Score = 45.2 bits (102), Expect = 3e-05 Identities = 26/75 (34%), Positives = 43/75 (57%) Frame = +2 Query: 290 GNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 469 G RGR S +P G G G R + +L V N+ + ++ED++ F +FG +K+I+L Sbjct: 15 GRRGR--SPSPRGRYG--GRSRDLPTSLL-VRNLRHDCRQEDLRKSFEQFGPVKDIYLPR 69 Query: 470 DRRTGFLKGYALVEY 514 D TG +G+ V++ Sbjct: 70 DYYTGDPRGFGFVQF 84 >At3g13570.1 68416.m01707 SC35-like splicing factor, 30a kD (SCL30a) almost identical to SC35-like splicing factor SCL30a GI:9843661 from [Arabidopsis thaliana]; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 44.8 bits (101), Expect = 4e-05 Identities = 25/75 (33%), Positives = 42/75 (56%) Frame = +2 Query: 290 GNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 469 G RGR S +P G G G + S L V N+ + ++ED++ F +FG +K+I+L Sbjct: 15 GRRGR--SPSPRGRFG--GSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPR 70 Query: 470 DRRTGFLKGYALVEY 514 D TG +G+ +++ Sbjct: 71 DYYTGDPRGFGFIQF 85 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 44.8 bits (101), Expect = 4e-05 Identities = 28/76 (36%), Positives = 36/76 (47%) Frame = +2 Query: 293 NRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD 472 N G YD P GDS G LFV + E+ ++ S++G IKN+ L Sbjct: 46 NAGLYD---PSGDSKAVGDPYCT----LFVGRLSHHTTEDTLREVMSKYGRIKNLRLVRH 98 Query: 473 RRTGFLKGYALVEYET 520 TG +GY VEYET Sbjct: 99 IVTGASRGYGFVEYET 114 >At1g16610.2 68414.m01990 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 407 Score = 43.6 bits (98), Expect = 8e-05 Identities = 21/83 (25%), Positives = 38/83 (45%) Frame = +2 Query: 269 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 448 G S A RGR P + +P + E +L V ++ E ++ F FGE+ Sbjct: 65 GKSPAGPARRGRSPPPPPSKGASSPSKKAVQESLVLHVDSLSRNVNEAHLKEIFGNFGEV 124 Query: 449 KNIHLNLDRRTGFLKGYALVEYE 517 ++ + +DR +G+ VE++ Sbjct: 125 IHVEIAMDRAVNLPRGHGYVEFK 147 >At1g16610.1 68414.m01989 arginine/serine-rich protein, putative (SR45) similar to arginine/serine-rich protein GI:6601502 from [Arabidopsis thaliana] Length = 414 Score = 43.6 bits (98), Expect = 8e-05 Identities = 21/83 (25%), Positives = 38/83 (45%) Frame = +2 Query: 269 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 448 G S A RGR P + +P + E +L V ++ E ++ F FGE+ Sbjct: 65 GKSPAGPARRGRSPPPPPSKGASSPSKKAVQESLVLHVDSLSRNVNEAHLKEIFGNFGEV 124 Query: 449 KNIHLNLDRRTGFLKGYALVEYE 517 ++ + +DR +G+ VE++ Sbjct: 125 IHVEIAMDRAVNLPRGHGYVEFK 147 >At5g51300.2 68418.m06360 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 41.9 bits (94), Expect = 3e-04 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 1/116 (0%) Frame = +2 Query: 170 EEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPE-GDSGTPG 346 + F + G + LK+ A G G + G + N G S P G + T Sbjct: 417 QNFLAELGGTVPESSLKQSATLALGPG----SSGSNPPWANNAGNGASAHPGLGSTPTKP 472 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 P + + L++ + +++ + N FS FGEI + DR TG KGY V+Y Sbjct: 473 PSKEYDETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKY 528 >At5g51300.1 68418.m06359 splicing factor-related contains similarity to SF1 protein [Drosophila melanogaster] GI:6687400 Length = 804 Score = 41.9 bits (94), Expect = 3e-04 Identities = 32/116 (27%), Positives = 50/116 (43%), Gaps = 1/116 (0%) Frame = +2 Query: 170 EEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPE-GDSGTPG 346 + F + G + LK+ A G G + G + N G S P G + T Sbjct: 417 QNFLAELGGTVPESSLKQSATLALGPG----SSGSNPPWANNAGNGASAHPGLGSTPTKP 472 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 P + + L++ + +++ + N FS FGEI + DR TG KGY V+Y Sbjct: 473 PSKEYDETNLYIGFLPPMLEDDGLINLFSSFGEIVMAKVIKDRVTGLSKGYGFVKY 528 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 41.1 bits (92), Expect = 4e-04 Identities = 18/61 (29%), Positives = 34/61 (55%) Frame = +2 Query: 335 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G GP + + L V N+ +D+ F+++G++ ++ + DRRTG +G+A V Y Sbjct: 5 GRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRY 64 Query: 515 E 517 + Sbjct: 65 K 65 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 41.1 bits (92), Expect = 4e-04 Identities = 18/61 (29%), Positives = 34/61 (55%) Frame = +2 Query: 335 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G GP + + L V N+ +D+ F+++G++ ++ + DRRTG +G+A V Y Sbjct: 5 GRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRY 64 Query: 515 E 517 + Sbjct: 65 K 65 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 41.1 bits (92), Expect = 4e-04 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 8/118 (6%) Frame = +2 Query: 191 DGEQGIARLKEKARKRKGRGFGN--EAGGGSAAERGNRGRYDS------LAPEGDSGTPG 346 D E+ I L + K KG GF G A + + D LA G+ GT Sbjct: 100 DLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLAASGNQGTGS 159 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 + ++V+NV + + + N F +G+++ L D+ TG +G+AL Y+T Sbjct: 160 QIADISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKT 217 Score = 33.5 bits (73), Expect = 0.088 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + E +++ FS +G+++ + LD+ TG KGY V + Sbjct: 77 LFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTF 123 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 41.1 bits (92), Expect = 4e-04 Identities = 32/118 (27%), Positives = 52/118 (44%), Gaps = 8/118 (6%) Frame = +2 Query: 191 DGEQGIARLKEKARKRKGRGFGN--EAGGGSAAERGNRGRYDS------LAPEGDSGTPG 346 D E+ I L + K KG GF G A + + D LA G+ GT Sbjct: 100 DLEEAIVILDKVTGKSKGYGFVTFMHVDGALLALKEPSKKIDGRVTVTQLAASGNQGTGS 159 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 + ++V+NV + + + N F +G+++ L D+ TG +G+AL Y+T Sbjct: 160 QIADISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKT 217 Score = 33.5 bits (73), Expect = 0.088 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + E +++ FS +G+++ + LD+ TG KGY V + Sbjct: 77 LFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKGYGFVTF 123 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 41.1 bits (92), Expect = 4e-04 Identities = 20/49 (40%), Positives = 29/49 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 ++VSNV + + + FS FGEI+ L LD+ TG KG+AL Y + Sbjct: 229 IYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDKATGRPKGFALFVYRS 277 Score = 29.5 bits (63), Expect = 1.4 Identities = 11/49 (22%), Positives = 29/49 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + + + + + + F ++GEI++ +D+ +G KGY + +++ Sbjct: 130 IFVHGLGWDTKADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILFKS 178 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 40.3 bits (90), Expect = 8e-04 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +F+ + + EED+++ E GEI + L DR +G KGYA V ++T Sbjct: 118 VFIGGLPRDVGEEDLRDLCEEIGEIFEVRLMKDRDSGDSKGYAFVAFKT 166 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 40.3 bits (90), Expect = 8e-04 Identities = 22/79 (27%), Positives = 39/79 (49%), Gaps = 4/79 (5%) Frame = +2 Query: 290 GNRGRYDSLAPE----GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNI 457 G RGR P G G G +R L V N+ + + E+++ F FG ++++ Sbjct: 17 GGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDV 76 Query: 458 HLNLDRRTGFLKGYALVEY 514 ++ D +G +G+A VE+ Sbjct: 77 YIPRDYYSGQPRGFAFVEF 95 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 40.3 bits (90), Expect = 8e-04 Identities = 25/68 (36%), Positives = 33/68 (48%) Frame = +2 Query: 311 SLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 490 S AP G SG P +S L+VSN+ DI FS FG++ + + DR T Sbjct: 42 SSAPGGGSGGLAPSKST----LYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQS 97 Query: 491 KGYALVEY 514 +G A V Y Sbjct: 98 RGVAFVLY 105 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 ++VSNV E + + FS+FGEI+ L LD+ TG KG+ L Y++ Sbjct: 247 IYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKS 295 Score = 31.1 bits (67), Expect = 0.47 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + + + E + F ++GEI++ D+ +G KGY + Y++ Sbjct: 142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 ++VSNV E + + FS+FGEI+ L LD+ TG KG+ L Y++ Sbjct: 247 IYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKS 295 Score = 31.1 bits (67), Expect = 0.47 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + + + E + F ++GEI++ D+ +G KGY + Y++ Sbjct: 142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/49 (40%), Positives = 30/49 (61%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 ++VSNV E + + FS+FGEI+ L LD+ TG KG+ L Y++ Sbjct: 247 IYVSNVGAELDPQKLLMFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKS 295 Score = 31.1 bits (67), Expect = 0.47 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + + + E + F ++GEI++ D+ +G KGY + Y++ Sbjct: 142 IFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 39.5 bits (88), Expect = 0.001 Identities = 16/51 (31%), Positives = 29/51 (56%) Frame = +2 Query: 362 EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 EG +FV + E + D++ FS FG+I + + L+R TG +G+ + + Sbjct: 5 EGSRIFVGGLSPEVTDRDLERAFSRFGDILDCQIMLERDTGRSRGFGFITF 55 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/63 (30%), Positives = 30/63 (47%) Frame = +2 Query: 326 GDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 505 G T P +FV+NVH A ++ + F++FGE+ + D TG G A Sbjct: 502 GTLSTTRPLEDASSRTIFVANVHFGATKDSLSRHFNKFGEVLKAFIVTDPATGQPSGSAY 561 Query: 506 VEY 514 +E+ Sbjct: 562 IEF 564 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV +V A EE+I+ F + G + + L D+RTG +G V+Y T Sbjct: 122 LFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYAT 170 Score = 31.5 bits (68), Expect = 0.36 Identities = 14/45 (31%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD-----RRTGFLK 493 LFV +++++A E++++ F +FG +++++L D R GF+K Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVK 257 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 39.1 bits (87), Expect = 0.002 Identities = 19/49 (38%), Positives = 28/49 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV +V A EE+I+ F + G + + L D+RTG +G V+Y T Sbjct: 122 LFVGSVPRTATEEEIRPYFEQHGNVLEVALIKDKRTGQQQGCCFVKYAT 170 Score = 31.5 bits (68), Expect = 0.36 Identities = 14/45 (31%), Positives = 30/45 (66%), Gaps = 5/45 (11%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLD-----RRTGFLK 493 LFV +++++A E++++ F +FG +++++L D R GF+K Sbjct: 213 LFVGSLNKQATEKEVEEIFLQFGHVEDVYLMRDEYRQSRGCGFVK 257 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 39.1 bits (87), Expect = 0.002 Identities = 14/45 (31%), Positives = 31/45 (68%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 511 F S++ E+ ++++++ FS+ GE+ +H+ DR TG +G+A ++ Sbjct: 486 FSSSLGEDEIKKELRSHFSKCGEVTRVHVPTDRETGASRGFAYID 530 Score = 34.3 bits (75), Expect = 0.050 Identities = 19/59 (32%), Positives = 28/59 (47%) Frame = +2 Query: 338 TPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 TP Q LF N+ + DI+N F E GE+ ++ L+ G KGY +E+ Sbjct: 374 TPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAGEVVDVRLS-SFDDGSFKGYGHIEF 431 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/48 (37%), Positives = 26/48 (54%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 +FV N+ +A EE ++ E G + + L DR TG KGY EY+ Sbjct: 11 VFVGNIPYDATEEQLREICGEVGPVVSFRLVTDRETGKPKGYGFCEYK 58 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 ++V + + E D+ FS++GEI +++L D+ TG KG+A + YE Sbjct: 38 VYVGGIPFDLTEGDLLAVFSQYGEIVDVNLIRDKGTGKSKGFAFLAYE 85 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/66 (31%), Positives = 33/66 (50%) Frame = +2 Query: 317 APEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKG 496 A G G GP S L+V N+H E+D++ F FG ++ + + D TG KG Sbjct: 269 AAAGAGGMLGPY-SGGARRLYVGNLHINMSEDDLRKVFESFGSVELVQVPRD-ETGLCKG 326 Query: 497 YALVEY 514 + V++ Sbjct: 327 FGFVQF 332 Score = 29.9 bits (64), Expect = 1.1 Identities = 18/69 (26%), Positives = 33/69 (47%) Frame = +2 Query: 308 DSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGF 487 D + PE D P+R +F + A E D+ FS G+++++ + +DR + Sbjct: 169 DKVEPEAD-----PERDQR--TVFAYQIALRATERDVYEFFSRAGKVRDVRIIMDRISRR 221 Query: 488 LKGYALVEY 514 +G VE+ Sbjct: 222 SRGIGYVEF 230 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 335 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G+PGP S + +FV + E + + F++FG I ++ + D RT +G+ + Y Sbjct: 25 GSPGPSNSKK---IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISY 81 Query: 515 ET 520 ++ Sbjct: 82 DS 83 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 335 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G+PGP S + +FV + E + + F++FG I ++ + D RT +G+ + Y Sbjct: 98 GSPGPSNSKK---IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISY 154 Query: 515 ET 520 ++ Sbjct: 155 DS 156 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +2 Query: 359 VEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +E LF+ + E E+ +++ F FGE+ + DR TG +G+ V + Sbjct: 3 MESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF 54 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/62 (27%), Positives = 33/62 (53%) Frame = +2 Query: 335 GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G+PGP S + +FV + E + + F++FG I ++ + D RT +G+ + Y Sbjct: 98 GSPGPSNSKK---IFVGGLASSVTEAEFKKYFAQFGMITDVVVMYDHRTQRPRGFGFISY 154 Query: 515 ET 520 ++ Sbjct: 155 DS 156 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +2 Query: 359 VEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +E LF+ + E E+ +++ F FGE+ + DR TG +G+ V + Sbjct: 3 MESCKLFIGGISWETSEDRLRDYFHSFGEVLEAVIMKDRATGRARGFGFVVF 54 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/47 (31%), Positives = 26/47 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 L+V N+H E ++ F FG ++ + L LD TG KG+ +++ Sbjct: 267 LYVGNLHFNMSELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQF 313 Score = 29.9 bits (64), Expect = 1.1 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +2 Query: 185 DEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGR 304 + GE+G + +R +K RG G E GGG R R Sbjct: 42 ERQGEEGGEEERVSSRSKKSRGDGEENGGGKRDRERERHR 81 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 37.5 bits (83), Expect = 0.005 Identities = 28/121 (23%), Positives = 60/121 (49%), Gaps = 4/121 (3%) Frame = +2 Query: 164 NSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAE--RGNRGRY-DSLAPEGDS 334 +S++ + +++ E+ ++K + +K G ++ A + + G+ DS E + Sbjct: 579 SSQKRKAEQNVEEESLAKRQKRKSQKEVDLGGQSATVPATKNVKAENGKTADSDKEETED 638 Query: 335 GTP-GPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 511 P P+ + F+SN+ +AQEEDI+ F + G + +I + + TG +G A + Sbjct: 639 AKPLKPKVYRDECTAFISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYAD 698 Query: 512 Y 514 + Sbjct: 699 F 699 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 37.5 bits (83), Expect = 0.005 Identities = 28/121 (23%), Positives = 60/121 (49%), Gaps = 4/121 (3%) Frame = +2 Query: 164 NSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAE--RGNRGRY-DSLAPEGDS 334 +S++ + +++ E+ ++K + +K G ++ A + + G+ DS E + Sbjct: 579 SSQKRKAEQNVEEESLAKRQKRKSQKEVDLGGQSATVPATKNVKAENGKTADSDKEETED 638 Query: 335 GTP-GPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 511 P P+ + F+SN+ +AQEEDI+ F + G + +I + + TG +G A + Sbjct: 639 AKPLKPKVYRDECTAFISNLSVKAQEEDIRKFFGDDGGVDSIRILHHKDTGKPRGLAYAD 698 Query: 512 Y 514 + Sbjct: 699 F 699 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 37.1 bits (82), Expect = 0.007 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFVS + E +Q+ F+ FG++ + + DR +G KG+ V Y T Sbjct: 36 LFVSGLSRLTTNEKLQDAFASFGQLVDARVITDRDSGRSKGFGFVTYAT 84 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 36.7 bits (81), Expect = 0.009 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + +++ + F +FGE+K + D TG +G+ V YE+ Sbjct: 132 IFVGGIPSSVDDDEFKEFFMQFGELKEHQIMRDHSTGRSRGFGFVTYES 180 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E + F ++GEI + + DR+TG +G+ V Y Sbjct: 44 IFVGGLARETTSAEFLKHFGKYGEITDSVIMKDRKTGQPRGFGFVTY 90 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 36.7 bits (81), Expect = 0.009 Identities = 22/68 (32%), Positives = 28/68 (41%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 L P G GP R +FV + E ++ FG +K L DR TG K Sbjct: 347 LTPGASGGLEGPDR------IFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSK 400 Query: 494 GYALVEYE 517 GYA Y+ Sbjct: 401 GYAFCVYQ 408 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 36.7 bits (81), Expect = 0.009 Identities = 22/68 (32%), Positives = 28/68 (41%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 L P G GP R +FV + E ++ FG +K L DR TG K Sbjct: 347 LTPGASGGLEGPDR------IFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSK 400 Query: 494 GYALVEYE 517 GYA Y+ Sbjct: 401 GYAFCVYQ 408 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 36.7 bits (81), Expect = 0.009 Identities = 22/68 (32%), Positives = 28/68 (41%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 L P G GP R +FV + E ++ FG +K L DR TG K Sbjct: 347 LTPGASGGLEGPDR------IFVGGLPYYFTESQVRELLESFGGLKGFDLVKDRETGNSK 400 Query: 494 GYALVEYE 517 GYA Y+ Sbjct: 401 GYAFCVYQ 408 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 36.7 bits (81), Expect = 0.009 Identities = 16/57 (28%), Positives = 33/57 (57%) Frame = +2 Query: 323 EGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 +G+SG P + +FV V + E+D+++ F +FGE+ ++ + +R GF++ Sbjct: 267 QGNSGESDPTNTT----IFVGAVDQSVTEDDLKSVFGQFGELVHVKIPAGKRCGFVQ 319 >At5g59950.3 68418.m07518 RNA and export factor-binding protein, putative Length = 242 Score = 36.3 bits (80), Expect = 0.012 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 365 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G L++SN+ EDI+ F+E GE+K ++ D R+G KG A V Y Sbjct: 85 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFD-RSGRSKGTAEVVY 133 >At5g59950.2 68418.m07519 RNA and export factor-binding protein, putative Length = 178 Score = 36.3 bits (80), Expect = 0.012 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 365 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G L++SN+ EDI+ F+E GE+K ++ D R+G KG A V Y Sbjct: 21 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFD-RSGRSKGTAEVVY 69 >At5g59950.1 68418.m07517 RNA and export factor-binding protein, putative Length = 244 Score = 36.3 bits (80), Expect = 0.012 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +2 Query: 365 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G L++SN+ EDI+ F+E GE+K ++ D R+G KG A V Y Sbjct: 87 GTKLYISNLDYGVMNEDIKELFAEVGELKRYTVHFD-RSGRSKGTAEVVY 135 >At5g18810.1 68418.m02235 SC35-like splicing factor, 28 kD (SCL28) nearly identical to SC35-like splicing factor SCL28, 28 kD [Arabidopsis thaliana] GI:9843655; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 236 Score = 36.3 bits (80), Expect = 0.012 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 L + N+ +A+ D+++ F FG +K+I+L + TG +G+ V+Y Sbjct: 49 LLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKY 95 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 36.3 bits (80), Expect = 0.012 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 FV + E+ I+ F+EFGE+ + + +DR TG KG+ V ++ Sbjct: 47 FVGGLAWATDEQSIERCFNEFGEVFDSKIIIDRETGRSKGFRFVTFK 93 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 35.9 bits (79), Expect = 0.017 Identities = 12/47 (25%), Positives = 27/47 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + E+ +++ FS FGE+ + + D+ +G +G+ V++ Sbjct: 43 LFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDF 89 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 35.9 bits (79), Expect = 0.017 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 +FV + E Q + ++ F +FGEI + D+ TG KGY V ++ Sbjct: 24 IFVGGLAWETQRDTMRRYFEQFGEIVEAVVITDKNTGRSKGYGFVTFK 71 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 35.9 bits (79), Expect = 0.017 Identities = 15/49 (30%), Positives = 33/49 (67%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LF+ N+ + +E+++ +F+ FGE++++ L L + T +G A V+++T Sbjct: 563 LFIRNLPFDVTKEEVKQRFTVFGEVESLSLVLHKVTKRPEGTAFVKFKT 611 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 35.9 bits (79), Expect = 0.017 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E Q E ++ F ++GEI + D+ TG KGY V + Sbjct: 26 VFVGGLAWETQSETLRQHFEQYGEILEAVVIADKNTGRSKGYGFVTF 72 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 35.9 bits (79), Expect = 0.017 Identities = 17/63 (26%), Positives = 34/63 (53%) Frame = +2 Query: 332 SGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVE 511 S +P S L+VS + E+ +++ F +FG + ++++ +D+ KG+A + Sbjct: 65 SSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFEQFGNLIHMNMVMDKVANRPKGFAFLR 124 Query: 512 YET 520 YET Sbjct: 125 YET 127 >At1g53720.1 68414.m06113 cyclophilin-RNA interacting protein, putative Length = 506 Score = 35.9 bits (79), Expect = 0.017 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 371 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 +LFV ++ ++ED+ FS FG + + + D +TG YA +E+E Sbjct: 244 VLFVCKLNPVTEDEDLHTIFSRFGTVVSADVIRDFKTGDSLCYAFIEFE 292 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 35.9 bits (79), Expect = 0.017 Identities = 20/74 (27%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = +2 Query: 278 AAERGNRGRYDSLAPEGDSGTPGPQRSVEG--WILFVSNVHEEAQEEDIQNQFSEFGEIK 451 AA G + +L G G G E +FV + + EED+ FS+FGE+ Sbjct: 295 AAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVV 354 Query: 452 NIHLNLDRRTGFLK 493 ++ + + + GF++ Sbjct: 355 SVKIPVGKGCGFVQ 368 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.9 bits (79), Expect = 0.017 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%) Frame = +2 Query: 272 GSAAERGNRGRYDSLAPEGDSGT-PGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 448 G A R G Y +GT P+ + +FV + +ED++ F+EFGEI Sbjct: 272 GPATPRKTNG-YQQQGGYMPNGTLTRPEGDIMNTTIFVGGLDSSVTDEDLKQPFNEFGEI 330 Query: 449 KNIHLNLDRRTGFLK 493 ++ + + + GF++ Sbjct: 331 VSVKIPVGKGCGFVQ 345 >At5g02530.1 68418.m00187 RNA and export factor-binding protein, putative BcDNA.LD24793, Drosophila melanogaster, EMBL:AF172637 Length = 292 Score = 35.5 bits (78), Expect = 0.022 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = +2 Query: 344 GPQRSVE-GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G S+E G L++SN+ EDI+ FSE G++K ++ D R+G KG A V + Sbjct: 99 GGGSSIETGTKLYISNLDYGVSNEDIKELFSEVGDLKRYGIHYD-RSGRSKGTAEVVF 155 >At4g10110.1 68417.m01654 RNA recognition motif (RRM)-containing protein contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 173 Score = 35.5 bits (78), Expect = 0.022 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +++ NV E + + + + G + ++H+ D+ T KG+A EYET Sbjct: 9 VYIGNVDERVSDRVLYDIMIQAGRVIDLHIPRDKETDKPKGFAFAEYET 57 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 35.5 bits (78), Expect = 0.022 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + +E+++ F +GEI+ + +D+ TG KGY V ++T Sbjct: 410 IFVRGFGWDTTQENLKTAFESYGEIEECSVVMDKDTGRGKGYGFVMFKT 458 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 35.5 bits (78), Expect = 0.022 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E ++ FS++GE+ + + +DR TG +G+A V + Sbjct: 36 IFVGGISYSTDEFGLREAFSKYGEVVDAKIIVDRETGRSRGFAFVTF 82 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 35.5 bits (78), Expect = 0.022 Identities = 16/48 (33%), Positives = 28/48 (58%) Frame = +2 Query: 371 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +LFV +H + +I++ S++G +K I +R +G KGY VE+ Sbjct: 203 MLFVGELHWWTTDAEIESVLSQYGRVKEIKFFDERVSGKSKGYCQVEF 250 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 35.5 bits (78), Expect = 0.022 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LF+ N+ E +++++ F FG++ + + +D+ TG K + + Y++ Sbjct: 341 LFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDS 389 Score = 30.7 bits (66), Expect = 0.62 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV + + E ++Q+ FSE+G IK++ + L KG ++YE+ Sbjct: 111 LFVGMLPKNVSETEVQSLFSEYGTIKDLQI-LRGSLQTSKGCLFLKYES 158 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 35.5 bits (78), Expect = 0.022 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LF+ N+ E +++++ F FG++ + + +D+ TG K + + Y++ Sbjct: 332 LFIYNIPREFEDQELAATFQPFGKVLSAKVFVDKATGISKCFGFISYDS 380 Score = 30.7 bits (66), Expect = 0.62 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV + + E ++Q+ FSE+G IK++ + L KG ++YE+ Sbjct: 102 LFVGMLPKNVSETEVQSLFSEYGTIKDLQI-LRGSLQTSKGCLFLKYES 149 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 35.1 bits (77), Expect = 0.029 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + E+ ++ F+++GE+ + + LDR TG +G+ V + Sbjct: 42 LFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSRGFGFVTF 88 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 35.1 bits (77), Expect = 0.029 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = +2 Query: 371 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 +L++ + E +I+ FS+FG +K + + +++TG K + +++E Sbjct: 61 VLYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSKHFGFIQFE 109 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 35.1 bits (77), Expect = 0.029 Identities = 16/48 (33%), Positives = 29/48 (60%) Frame = +2 Query: 371 ILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +L V + E+A EE ++ +FS+ IK++ L D+ T +G+A V + Sbjct: 459 VLVVRGLDEDADEEMLRYEFSKHAPIKDLRLVRDKFTHVSRGFAFVHF 506 Score = 30.3 bits (65), Expect = 0.82 Identities = 10/47 (21%), Positives = 28/47 (59%) Frame = +2 Query: 380 VSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 V + ++ EED+ +E+G + ++ + ++ +G +G+A +++ T Sbjct: 302 VKGLSMKSTEEDLYQILAEWGPLHHVRVIREQNSGISRGFAFIDFPT 348 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 35.1 bits (77), Expect = 0.029 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + EE ++ FS FGE+ + DR TG +G+ V + Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF 54 Score = 34.3 bits (75), Expect = 0.050 Identities = 18/73 (24%), Positives = 33/73 (45%) Frame = +2 Query: 302 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 481 R +S + +G G PG R + FV + E D + F +FG ++ + D T Sbjct: 91 RSNSSSIQGSPGGPGRTRKI-----FVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNT 145 Query: 482 GFLKGYALVEYET 520 +G+ + Y++ Sbjct: 146 QRPRGFGFITYDS 158 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 35.1 bits (77), Expect = 0.029 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + EE ++ FS FGE+ + DR TG +G+ V + Sbjct: 8 LFIGGISWDTNEERLKEYFSSFGEVIEAVILKDRTTGRARGFGFVVF 54 Score = 34.3 bits (75), Expect = 0.050 Identities = 18/73 (24%), Positives = 33/73 (45%) Frame = +2 Query: 302 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 481 R +S + +G G PG R + FV + E D + F +FG ++ + D T Sbjct: 91 RSNSSSIQGSPGGPGRTRKI-----FVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNT 145 Query: 482 GFLKGYALVEYET 520 +G+ + Y++ Sbjct: 146 QRPRGFGFITYDS 158 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/53 (28%), Positives = 29/53 (54%) Frame = +2 Query: 362 EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 EG LF+ N+ E ++++ F FG + + + +D+ TG K + V Y++ Sbjct: 347 EGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGFVSYDS 399 >At3g20930.1 68416.m02645 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 374 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LF++ + E+ ++ F FGE+ + + +D+ + KGYA +EY T Sbjct: 284 LFITGLSFYTSEKTLRAAFEGFGELVEVKIIMDKISKRSKGYAFLEYTT 332 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 34.7 bits (76), Expect = 0.038 Identities = 17/47 (36%), Positives = 31/47 (65%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 +V N+ + +E D++N FS+FG++ IH N+ R F ++L++YE Sbjct: 11 YVGNLESDTEENDLKNAFSQFGDV--IHSNV--RFSF--HFSLIDYE 51 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 34.7 bits (76), Expect = 0.038 Identities = 13/40 (32%), Positives = 25/40 (62%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 +FV + +ED++ FSEFGEI ++ + + + GF++ Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGKGCGFVQ 347 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 34.7 bits (76), Expect = 0.038 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E Q E ++ F ++G+I + D+ TG KGY V + Sbjct: 26 VFVGGLAWETQSETLRRHFDQYGDILEAVVITDKNTGRSKGYGFVTF 72 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 34.7 bits (76), Expect = 0.038 Identities = 18/75 (24%), Positives = 37/75 (49%) Frame = +2 Query: 269 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 448 G +A+++G G+ DS T +FV + ++ ++N FS++GEI Sbjct: 230 GPAASKKGVTGQRDSYQSSAAGVTT--DNDPNNTTVFVGGLDASVTDDHLKNVFSQYGEI 287 Query: 449 KNIHLNLDRRTGFLK 493 ++ + +R GF++ Sbjct: 288 VHVKIPAGKRCGFVQ 302 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 34.7 bits (76), Expect = 0.038 Identities = 18/75 (24%), Positives = 37/75 (49%) Frame = +2 Query: 269 GGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 448 G +A+++G G+ DS T +FV + ++ ++N FS++GEI Sbjct: 230 GPAASKKGVTGQRDSYQSSAAGVTT--DNDPNNTTVFVGGLDASVTDDHLKNVFSQYGEI 287 Query: 449 KNIHLNLDRRTGFLK 493 ++ + +R GF++ Sbjct: 288 VHVKIPAGKRCGFVQ 302 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 34.3 bits (75), Expect = 0.050 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 FV + +ED+Q FS+FG++ + + DR +G +G+ V ++ Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 34.3 bits (75), Expect = 0.050 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 FV + +ED+Q FS+FG++ + + DR +G +G+ V ++ Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 34.3 bits (75), Expect = 0.050 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 FV + +ED+Q FS+FG++ + + DR +G +G+ V ++ Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 34.3 bits (75), Expect = 0.050 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 FV + +ED+Q FS+FG++ + + DR +G +G+ V ++ Sbjct: 9 FVGGLAWATNDEDLQRTFSQFGDVIDSKIINDRESGRSRGFGFVTFK 55 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 34.3 bits (75), Expect = 0.050 Identities = 12/44 (27%), Positives = 27/44 (61%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYAL 505 L+V + ++D++ +FS+FG+I++ +R+T F+ Y + Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFGKIEDFRFLRERKTAFIDYYEM 295 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 34.3 bits (75), Expect = 0.050 Identities = 17/47 (36%), Positives = 24/47 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFV V E E N F +FGE+ + + DR TG +G+ V + Sbjct: 68 LFVGGVSWETTAETFANYFGKFGEVVDSVIMTDRITGNPRGFGFVTF 114 Score = 33.1 bits (72), Expect = 0.12 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + +E++++N F +G+I + D TG +G+ V ++T Sbjct: 159 IFVGGLPPLLEEDELKNYFCVYGDIIEHQIMYDHHTGRSRGFGFVTFQT 207 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 33.9 bits (74), Expect = 0.067 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E ++++ F +FGEI + D+ TG KGY V + Sbjct: 19 VFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTF 65 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 33.9 bits (74), Expect = 0.067 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E ++++ F +FGEI + D+ TG KGY V + Sbjct: 19 VFVGGLAWETPTDEMRRYFEQFGEILEAVIITDKNTGKSKGYGFVTF 65 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 33.5 bits (73), Expect = 0.088 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = +2 Query: 290 GNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 469 G R + AP G P+ + ++V N+ + ++ FSE G++ + + Sbjct: 181 GRRLTVNRAAPRGSRPERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHGKVVDARVVS 240 Query: 470 DRRTGFLKGYALVE 511 DR TG +G+ V+ Sbjct: 241 DRETGRSRGFGFVQ 254 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 33.5 bits (73), Expect = 0.088 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 + V N+ E+ ++ +FS FGEI + L D KGYA +++ Sbjct: 42 IMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQF 88 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 33.5 bits (73), Expect = 0.088 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFVS + ++ ++ FS FG+IK L D T KG+ + +++ Sbjct: 9 LFVSRLSAYTTDQSLRQLFSPFGQIKEARLIRDSETQRPKGFGFITFDS 57 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.5 bits (73), Expect = 0.088 Identities = 11/40 (27%), Positives = 26/40 (65%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 +FV + + +ED++ FS+FGE+ ++ + + + GF++ Sbjct: 323 IFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQ 362 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.5 bits (73), Expect = 0.088 Identities = 26/120 (21%), Positives = 50/120 (41%) Frame = +2 Query: 161 ENSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGT 340 E EE EV+E+ + + + A ++ A E G + E Sbjct: 149 ELEEEIEVEEEAGEFADEIGDGAEDLDSEDDDDD----HAIEEVKHGETVDVEEEEHHDV 204 Query: 341 PGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +R + + +FV ++ + A EED++ F GE+ + + + +T KG A + + T Sbjct: 205 LHERRKRKEFEIFVGSLDKGASEEDLKKVFGHVGEVTEVRILKNPQTKKSKGSAFLRFAT 264 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 33.5 bits (73), Expect = 0.088 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E ++++ F +FGEI + D+ TG KGY V + Sbjct: 19 VFVGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTF 65 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 33.1 bits (72), Expect = 0.12 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV + E ++ FSEFG++ N+ + + RT GY V + + Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNS 108 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 33.1 bits (72), Expect = 0.12 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV + E ++ FSEFG++ N+ + + RT GY V + + Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFGQVTNVKIIANERTRQSLGYGYVWFNS 127 >At3g12480.1 68416.m01553 transcription factor, putative Length = 293 Score = 33.1 bits (72), Expect = 0.12 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +2 Query: 161 ENSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGT 340 ++ EE++ + E G A+ + + +GRG G AAER R + +SG Sbjct: 121 DSDEEYKKSKTQEIGSAKTSGRGGRGRGRGRGRGGRAAKAAEREGLNR-EMEVEAANSGQ 179 Query: 341 PGPQRSVE 364 P P+ +V+ Sbjct: 180 PPPEDNVK 187 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 33.1 bits (72), Expect = 0.12 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +2 Query: 377 FVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 FV + ++ E+D+ + FS+FG + + + DR TG + + V +E Sbjct: 10 FVRGLDQDTDEKDLTDIFSKFGNVIDSKIIYDRDTGKSRRFGFVTFE 56 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.1 bits (72), Expect = 0.12 Identities = 21/68 (30%), Positives = 29/68 (42%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 L+ G GP R +FV + E I+ FG ++ +L DR TG K Sbjct: 363 LSSGSTGGLEGPDR------IFVGGLPYYFTEVQIRELLESFGPLRGFNLVKDRETGNSK 416 Query: 494 GYALVEYE 517 GYA Y+ Sbjct: 417 GYAFCVYQ 424 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 33.1 bits (72), Expect = 0.12 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E +E ++ F +FGEI + D+ +G KGY V + Sbjct: 15 VFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTF 61 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 33.1 bits (72), Expect = 0.12 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E +E ++ F +FGEI + D+ +G KGY V + Sbjct: 15 VFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTF 61 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 33.1 bits (72), Expect = 0.12 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E +E ++ F +FGEI + D+ +G KGY V + Sbjct: 15 VFVGGLAWETHKETMKKHFEQFGEILEAVVITDKASGRSKGYGFVTF 61 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 33.1 bits (72), Expect = 0.12 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + E ++ F FG+I + + LDR +G +G+ V Y++ Sbjct: 38 IFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDS 86 >At5g55670.1 68418.m06941 RNA recognition motif (RRM)-containing protein Length = 710 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/50 (26%), Positives = 28/50 (56%) Frame = +2 Query: 365 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G LFV ++H + +++ + ++G +K + ++ +G KGY VE+ Sbjct: 233 GAFLFVGDLHWWTTDAELEAELCKYGAVKEVKFFDEKASGKSKGYCQVEF 282 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 32.7 bits (71), Expect = 0.15 Identities = 16/49 (32%), Positives = 30/49 (61%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 L+++N+ + EE + FS+FG++ L D R G +G+A +E+E+ Sbjct: 19 LYIANLDAQVSEEMLFLMFSDFGKVIRSVLAKDFR-GESRGFAFIEFES 66 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 32.7 bits (71), Expect = 0.15 Identities = 19/70 (27%), Positives = 36/70 (51%) Frame = +2 Query: 305 YDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTG 484 YD+ A G P R + G +FV + +EA +D+++ F FG I++ ++ D + Sbjct: 221 YDNPATFYGRGEP-TTRGI-GNKIFVGRLPQEASVDDLRDYFGRFGHIQDAYIPKDPKRS 278 Query: 485 FLKGYALVEY 514 +G+ V + Sbjct: 279 GHRGFGFVTF 288 Score = 29.5 bits (63), Expect = 1.4 Identities = 10/49 (20%), Positives = 25/49 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV+ + E D ++ F +GEI ++++ D + +G + + + Sbjct: 93 IFVARIPSSVSESDFRSHFERYGEITDLYMPKDYNSKQHRGIGFITFSS 141 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 32.7 bits (71), Expect = 0.15 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 1/77 (1%) Frame = +2 Query: 293 NRGRYDSLAPEGDS-GTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNL 469 +RG S G G G + G ++V N+ + +++ FSE G++ + Sbjct: 178 SRGPRSSFGSSGSGYGGGGGSGAGSGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIY 237 Query: 470 DRRTGFLKGYALVEYET 520 DR +G KG+ V Y++ Sbjct: 238 DRDSGRSKGFGFVTYDS 254 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + E E + F +GEI+ + +D+ TG KG+ V ++T Sbjct: 106 IFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKT 154 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 32.7 bits (71), Expect = 0.15 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + E E + F +GEI+ + +D+ TG KG+ V ++T Sbjct: 106 IFVYGLPWETTRETLVGVFEGYGEIEECTVVIDKATGKAKGFGFVMFKT 154 >At1g59359.1 68414.m06677 40S ribosomal protein S2 (RPS2B) similar to ribosomal protein S2 GI:430711 from [Drosophila melanogaster] Length = 284 Score = 32.7 bits (71), Expect = 0.15 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +2 Query: 185 DEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGR 304 + GE G R + R GRGFG GGG +RG RGR Sbjct: 3 ERGGESGAERGGD--RGDFGRGFGGGRGGGRGRDRGPRGR 40 >At1g58983.1 68414.m06666 40S ribosomal protein S2, putative similar to ribosomal protein S2 GI:939717 from [Urechis caupo] Length = 284 Score = 32.7 bits (71), Expect = 0.15 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +2 Query: 185 DEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGR 304 + GE G R + R GRGFG GGG +RG RGR Sbjct: 3 ERGGESGAERGGD--RGDFGRGFGGGRGGGRGRDRGPRGR 40 >At1g58684.1 68414.m06657 40S ribosomal protein S2, putative Length = 284 Score = 32.7 bits (71), Expect = 0.15 Identities = 18/40 (45%), Positives = 21/40 (52%) Frame = +2 Query: 185 DEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGR 304 + GE G R + R GRGFG GGG +RG RGR Sbjct: 3 ERGGESGAERGGD--RGDFGRGFGGGRGGGRGRDRGPRGR 40 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + EE+ +N F +FG I ++ + D T +G+ + +++ Sbjct: 112 IFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDS 160 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + EE+ +N F +FG I ++ + D T +G+ + +++ Sbjct: 112 IFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDS 160 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 32.3 bits (70), Expect = 0.20 Identities = 12/49 (24%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + EE+ +N F +FG I ++ + D T +G+ + +++ Sbjct: 112 IFVGGLPSSITEEEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDS 160 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 32.3 bits (70), Expect = 0.20 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 508 +++ NV EE + FS GEIK I + LD+ T G+ V Sbjct: 36 VYIGNVSFYTTEEQLYELFSRAGEIKKIIMGLDKNTKTPCGFCFV 80 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 32.3 bits (70), Expect = 0.20 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = +2 Query: 194 GEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEG 367 G++ E+ R GRGFG GGG RG R ++ + G+S P P G Sbjct: 1074 GKKDEGGYSEQTFDRGGRGFGGRRGGG---RRGGRDQFGRGSSFGNSEDPAPWSKPSG 1128 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 32.3 bits (70), Expect = 0.20 Identities = 13/45 (28%), Positives = 24/45 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALV 508 LFV + E E+ ++ F+ +GE+ + D+ TG +G+ V Sbjct: 8 LFVGGISWETDEDKLREHFTNYGEVSQAIVMRDKLTGRPRGFGFV 52 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + + E+++ F +GEI + +D+ TG KG+ V ++T Sbjct: 165 IFVRGLGWDTTHENLKAAFEVYGEITECSVVMDKDTGRAKGFGFVLFKT 213 >At1g31290.1 68414.m03829 PAZ domain-containing protein / piwi domain-containing protein contains Pfam profiles PF02170: PAZ domain, PF02171: Piwi domain Length = 1194 Score = 32.3 bits (70), Expect = 0.20 Identities = 17/51 (33%), Positives = 23/51 (45%) Frame = +2 Query: 221 EKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEGWI 373 ++ R GRG G+ GGG RG GR + D G P +S G + Sbjct: 76 DRGRGYSGRGDGHGRGGGGDRGRGYSGRGRGFVQDRDGGWVNPGQSSGGHV 126 Score = 28.7 bits (61), Expect = 2.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +2 Query: 236 RKGRGFGNEAGGGSAAERGNRGRYDSLAPEGD 331 R GRG G GGG RG GR D GD Sbjct: 7 RGGRGDGRGRGGGGDRGRGYSGRGDGRGRGGD 38 Score = 27.5 bits (58), Expect = 5.8 Identities = 18/49 (36%), Positives = 20/49 (40%) Frame = +2 Query: 221 EKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVEG 367 ++ R GRG G GGG RG GR D G G G S G Sbjct: 57 DRGRGYSGRGDGRGRGGGGDRGRGYSGRGDGHG-RGGGGDRGRGYSGRG 104 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 31.9 bits (69), Expect = 0.27 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 ++V + ++E + N F FGEI ++++ DR T +GY V ++ Sbjct: 15 IYVGGLPWTTRKEGLINFFKRFGEIIHVNVVCDRETDRSQGYGFVTFK 62 >At5g41690.1 68418.m05067 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GI:7673355 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 620 Score = 31.9 bits (69), Expect = 0.27 Identities = 20/56 (35%), Positives = 32/56 (57%) Frame = +2 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 P SVE +LFV+N+ + + DI + F+ GE+ +I L ++ G GY VE+ Sbjct: 238 PPNSVEE-VLFVANLSPQTKISDIFDFFNCVGEVVSIRLMVNHE-GKHVGYGFVEF 291 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFV+++ + + I N F + GE+ ++ L L+ TG G A VE+ Sbjct: 361 LFVAHLSRKTEITHIINFFKDVGEVVHVRLILN-HTGKHVGCAFVEF 406 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 31.9 bits (69), Expect = 0.27 Identities = 16/64 (25%), Positives = 29/64 (45%) Frame = +2 Query: 317 APEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKG 496 AP G P+ + ++V N+ + ++ FSE G++ + DR TG +G Sbjct: 227 APRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRG 286 Query: 497 YALV 508 + V Sbjct: 287 FGFV 290 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/48 (27%), Positives = 29/48 (60%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 L++ N+ + E+ ++ +F+EFG+I ++ + D +GYA V ++ Sbjct: 203 LYMKNLDADVSEDLLREKFAEFGKIVSLAIAKDENR-LCRGYAFVNFD 249 Score = 31.9 bits (69), Expect = 0.27 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 ++V NV+ EE+++ FS+ G I + L D + G KG+ V + T Sbjct: 306 IYVKNVNVAVTEEELRKHFSQCGTITSTKLMCDEK-GKSKGFGFVCFST 353 >At1g58380.1 68414.m06642 40S ribosomal protein S2 (RPS2A) similar to ribosomal protein S2 GI:939717 from (Urechis caupo) Length = 284 Score = 31.9 bits (69), Expect = 0.27 Identities = 13/21 (61%), Positives = 14/21 (66%) Frame = +2 Query: 242 GRGFGNEAGGGSAAERGNRGR 304 GRGFG GGG +RG RGR Sbjct: 20 GRGFGGGRGGGRGRDRGPRGR 40 >At1g45100.1 68414.m05170 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Nicotiana tabacum] GI:7673355, [Cucumis sativus] GI:7528270; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 497 Score = 31.9 bits (69), Expect = 0.27 Identities = 16/47 (34%), Positives = 28/47 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFV+N+ + Q DI N F + GE+ ++ L ++ + G G+ VE+ Sbjct: 249 LFVANLRDSIQISDIINFFKDVGEVVHVRLIVNSQ-GKHAGWGFVEF 294 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/47 (34%), Positives = 26/47 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFVS + + + DI + FS+ GE+ N+ + L TG AL+ + Sbjct: 66 LFVSELSRQTKISDIIDFFSDVGEVVNVRICLS-HTGSCCVLALLSF 111 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 31.9 bits (69), Expect = 0.27 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E + ++N F +FG+I + D+ +G KGY V + Sbjct: 9 VFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 31.9 bits (69), Expect = 0.27 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV + E + ++N F +FG+I + D+ +G KGY V + Sbjct: 9 VFVGGLAWETHKVSLRNYFEQFGDIVEAVVITDKSSGRSKGYGFVTF 55 >At1g07360.1 68414.m00785 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}, RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 481 Score = 31.9 bits (69), Expect = 0.27 Identities = 17/59 (28%), Positives = 29/59 (49%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 490 L G+ GT L+V ++ E+DI++QF GEI++I + D+ F+ Sbjct: 210 LGKAGEMGTLESPDDESIKTLYVGGLNSRILEQDIRDQFYAHGEIESIRILADKACAFV 268 >At5g37720.1 68418.m04541 RNA and export factor-binding protein, putative transcriptional coactivator ALY, Mus musculus, EMBL:MMU89876 Length = 288 Score = 31.5 bits (68), Expect = 0.36 Identities = 18/50 (36%), Positives = 27/50 (54%) Frame = +2 Query: 365 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G L V+N+ + EDI+ FSE GE++ ++ D + G G A V Y Sbjct: 92 GTRLHVTNLDQGVTNEDIRELFSEIGEVERYAIHYD-KNGRPSGTAEVVY 140 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 31.5 bits (68), Expect = 0.36 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFV + + ++ F+ FGE+ + DR TG +G+ V + Sbjct: 37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSF 83 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 31.5 bits (68), Expect = 0.36 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LFV + + ++ F+ FGE+ + DR TG +G+ V + Sbjct: 37 LFVGGLSWGTDDSSLKQAFTSFGEVTEATVIADRETGRSRGFGFVSF 83 >At2g42890.2 68415.m05312 RNA recognition motif (RRM)-containing protein Length = 830 Score = 31.5 bits (68), Expect = 0.36 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 6/84 (7%) Frame = +2 Query: 257 NEAGGGSAAERGNRGRYDSLAPEGDSGTPG------PQRSVEGWILFVSNVHEEAQEEDI 418 N A S + +RG ++ P T G P LFV N++ ++ ++ Sbjct: 142 NHAVDASGMQISDRGAANAFVPRKRPNTAGRVSVEHPNGEHPSRTLFVRNINSSVEDSEL 201 Query: 419 QNQFSEFGEIKNIHLNLDRRTGFL 490 F FGEI++++ R GF+ Sbjct: 202 SALFEPFGEIRSLYTACKSR-GFV 224 >At2g42890.1 68415.m05311 RNA recognition motif (RRM)-containing protein Length = 843 Score = 31.5 bits (68), Expect = 0.36 Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 6/84 (7%) Frame = +2 Query: 257 NEAGGGSAAERGNRGRYDSLAPEGDSGTPG------PQRSVEGWILFVSNVHEEAQEEDI 418 N A S + +RG ++ P T G P LFV N++ ++ ++ Sbjct: 155 NHAVDASGMQISDRGAANAFVPRKRPNTAGRVSVEHPNGEHPSRTLFVRNINSSVEDSEL 214 Query: 419 QNQFSEFGEIKNIHLNLDRRTGFL 490 F FGEI++++ R GF+ Sbjct: 215 SALFEPFGEIRSLYTACKSR-GFV 237 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 31.5 bits (68), Expect = 0.36 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + E ++ FS FGE+ + + ++ TG +G+ V + Sbjct: 8 LFIGGISWDTDENLLREYFSNFGEVLQVTVMREKATGRPRGFGFVAF 54 >At2g29580.1 68415.m03592 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein similar to SP|O59800 Cell cycle control protein cwf5 {Schizosaccharomyces pombe}; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 483 Score = 31.5 bits (68), Expect = 0.36 Identities = 16/59 (27%), Positives = 29/59 (49%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 490 L G+ GT L+V ++ E+DI++QF GEI++I + ++ F+ Sbjct: 210 LGKAGEMGTLESPEDQSIRTLYVGGLNSRVLEQDIRDQFYAHGEIESIRILAEKACAFV 268 >At1g05890.1 68414.m00617 zinc finger protein-related contains low similarity to zinc finger proteins and Pfam PF01485: IBR domain Length = 552 Score = 31.5 bits (68), Expect = 0.36 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 4/52 (7%) Frame = -2 Query: 349 RSWCTAIAFRS*T---VVS-SAVTPFCSTASTGFIAKTTTFSLTCLLLKSSD 206 R + I F S T +VS S PFC+T TG+I+ T CL+LK D Sbjct: 128 REFTCGICFDSYTLEEIVSVSCGHPFCATCWTGYISTTINDGPGCLMLKCPD 179 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 31.5 bits (68), Expect = 0.36 Identities = 14/47 (29%), Positives = 28/47 (59%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 ++V N+ Q + ++N FS+FG I + + DR+TG + +A + + Sbjct: 214 VYVGNLPWFTQPDGLRNHFSKFGTIVSTRVLHDRKTGRNRVFAFLSF 260 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 31.1 bits (67), Expect = 0.47 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSE-FGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV ++ E + + + F +G +K + LDR TG KGY V + Sbjct: 156 IFVGDLAPEVTDYMLSDTFKNVYGSVKGAKVVLDRTTGRSKGYGFVRF 203 Score = 28.7 bits (61), Expect = 2.5 Identities = 9/40 (22%), Positives = 25/40 (62%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 +FV + ++++++ F +FGE+ ++ + +R GF++ Sbjct: 262 IFVGGLDANVTDDELKSIFGQFGELLHVKIPPGKRCGFVQ 301 >At5g07290.1 68418.m00832 RNA recognition motif (RRM)-containing protein Mei2-like protein - Arabidopsis thaliana, EMBL:D86122 Length = 907 Score = 31.1 bits (67), Expect = 0.47 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = +2 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 PQ + ILFV NV ++ ++ F +FG+++ +H G +G+ +V Y Sbjct: 204 PQGEILSRILFVRNVDSSIEDCELGVLFKQFGDVRALH-----TAGKNRGFIMVSY 254 >At4g26110.1 68417.m03759 nucleosome assembly protein (NAP), putative similar to nucleosome assembly protein 1 [Glycine max] GI:1161252; contains Pfam profile PF00956: Nucleosome assembly protein (NAP) Length = 372 Score = 31.1 bits (67), Expect = 0.47 Identities = 18/57 (31%), Positives = 29/57 (50%) Frame = +2 Query: 155 DIENSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPE 325 DI+ E+ E +ED E +E+++ +K GN+ GG S + G+ D PE Sbjct: 314 DIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRS--QIVGEGKQDERPPE 368 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 31.1 bits (67), Expect = 0.47 Identities = 11/47 (23%), Positives = 26/47 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + +++ F+ FG++ + + +DR TG +G+ V + Sbjct: 37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 31.1 bits (67), Expect = 0.47 Identities = 11/47 (23%), Positives = 26/47 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF+ + + +++ F+ FG++ + + +DR TG +G+ V + Sbjct: 37 LFIGGLSWGTDDASLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNF 83 >At3g47820.1 68416.m05211 armadillo/beta-catenin repeat family protein / U-box domain-containing protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 509 Score = 31.1 bits (67), Expect = 0.47 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +2 Query: 191 DGEQGIARLKEKARK--RKGRGFGNEAGGGSAAERGNR 298 + E G RLKEKA K + RG G+E G G+ A NR Sbjct: 445 ESESGSGRLKEKASKILQTLRGGGSEFGEGAEAREWNR 482 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 31.1 bits (67), Expect = 0.47 Identities = 13/49 (26%), Positives = 27/49 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV + + EE + FS++G++ + + +D+ KG+A V + + Sbjct: 23 LFVKGISFSSTEETLTQAFSQYGQVLKVDVIMDKIRCRPKGFAYVTFSS 71 >At1g66260.1 68414.m07522 RNA and export factor-binding protein, putative similar to GI:7159943 from [Mus musculus] (RNA 6 (4), 638-650 (2000)) Length = 295 Score = 31.1 bits (67), Expect = 0.47 Identities = 15/50 (30%), Positives = 28/50 (56%) Frame = +2 Query: 365 GWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 G ++++N+ + EDI+ ++E GE+K ++ D + G G A V Y Sbjct: 106 GTTVYITNLDQGVTNEDIRELYAEIGELKRYAIHYD-KNGRPSGSAEVVY 154 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 30.7 bits (66), Expect = 0.62 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 5/67 (7%) Frame = +2 Query: 302 RYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNI-----HLN 466 R D+ PE ++ P + EG I FV N+ ++ + + F +FG I+N+ H Sbjct: 144 RSDTKPPEEETRNPQQEFRQEGKI-FVGNLPTWIKKPEFEEFFRQFGPIENVILIKGHHE 202 Query: 467 LDRRTGF 487 +++ GF Sbjct: 203 VEKNAGF 209 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 30.7 bits (66), Expect = 0.62 Identities = 13/52 (25%), Positives = 28/52 (53%) Frame = +2 Query: 362 EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYE 517 EG LF+ N+ E ++++ F FG + + + +D+ TG K + + ++ Sbjct: 346 EGANLFIYNIPREFGDQELAAAFQSFGIVLSAKVFVDKATGVSKCFGKLSFD 397 >At2g41840.1 68415.m05171 40S ribosomal protein S2 (RPS2C) Length = 285 Score = 30.7 bits (66), Expect = 0.62 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +2 Query: 185 DEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGR 304 + GE+G+ R E R GRGFG G G RG GR Sbjct: 3 ERGGERGVERGGE--RGDFGRGFGGRGGRGDRGGRGRGGR 40 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 30.3 bits (65), Expect = 0.82 Identities = 16/58 (27%), Positives = 32/58 (55%) Frame = +2 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 P+ V + V+N+ + EE+++ FS+ GE+ I++ + KGY V+++T Sbjct: 230 PESDVTCTTISVANLDQNVTEEELKKAFSQLGEV--IYVKIPA----TKGYGYVQFKT 281 Score = 28.7 bits (61), Expect = 2.5 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +2 Query: 347 PQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 PQ E L++ ++ E + + FS+ GE+ ++ + ++ TG +GY +E+ Sbjct: 17 PQTLEEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEF 72 >At3g57490.1 68416.m06400 40S ribosomal protein S2 (RPS2D) 40S ribosomal protein S2 - Arabidopsis thaliana, SWISSPROT:RS2_ARATH Length = 276 Score = 30.3 bits (65), Expect = 0.82 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +2 Query: 242 GRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTP 343 GRGFG GGG RG RGR APE + P Sbjct: 16 GRGFGGR-GGGRGGPRG-RGRRAGRAPEEEKWVP 47 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 30.3 bits (65), Expect = 0.82 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 LFV N+ E + F E G++ + D TG +GY V Y + Sbjct: 179 LFVGNLSWTVTSESLAGAFRECGDVVGARVVFDGDTGRSRGYGFVCYSS 227 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/49 (22%), Positives = 25/49 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + E + +N F +FG I ++ + D T +G+ + +++ Sbjct: 124 IFVGGLPSSITEAEFKNYFDQFGTIADVVVMYDHNTQRPRGFGFITFDS 172 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.9 bits (64), Expect = 1.1 Identities = 11/47 (23%), Positives = 25/47 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV N+ +D++ F +FG++ + ++ + G KGY + + Sbjct: 14 IFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITF 60 >At2g31510.1 68415.m03850 IBR domain-containing protein / ARIADNE-like protein ARI7 (ARI7) identical to ARIADNE-like protein ARI7 [Arabidopsis thaliana] GI:29125028; contains similarity to Swiss-Prot:Q94981 ariadne-1 protein (Ari-1) [Drosophila melanogaster]; contains Pfam profile PF01485: IBR domain Length = 562 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 289 PFCSTASTGFIAKTTTFSLTCLLLKSSD 206 PFC+T TG+I+ T CL+L+ D Sbjct: 157 PFCTTCWTGYISTTINDGPGCLMLRCPD 184 >At5g37055.1 68418.m04446 zinc finger (HIT type) family protein contains Pfam profile: PF04438 HIT zinc finger Length = 171 Score = 29.5 bits (63), Expect = 1.4 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 146 DVLDIENSEEFEVDEDGEQGIARLKE-KARKRKGR 247 +V+D+ + EE +DED + G + K+ K KRK R Sbjct: 50 EVIDLNDDEEASLDEDDDLGYLQKKQHKGSKRKTR 84 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +2 Query: 242 GRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGP 349 GRG G GG ++RG RGR G G GP Sbjct: 33 GRGGGGRGGGRGFSDRGGRGRGRGPPRGGARGGRGP 68 >At3g04500.1 68416.m00477 RNA recognition motif (RRM)-containing protein similar to ssRNA-binding protein [Dictyostelium discoideum] GI:1546894; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 LF ++ E ++ + F+ F + D+RTG KGY V + Sbjct: 139 LFCGDLGNEVNDDVLSKAFARFPTFNMAKVIRDKRTGKTKGYGFVSF 185 >At5g07060.1 68418.m00799 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 363 Score = 29.1 bits (62), Expect = 1.9 Identities = 14/50 (28%), Positives = 25/50 (50%) Frame = +2 Query: 314 LAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHL 463 L G+ GT P L+V ++ E+DI + F +GE+++I + Sbjct: 207 LRKAGEMGTLEPPEDESIKTLYVGGLNSRIFEQDIHDHFYAYGEMESIRV 256 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 29.1 bits (62), Expect = 1.9 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +++ + +A E D++ GE+ + + ++ +G KGYA V + + Sbjct: 94 VYLGGIPTDATEGDLKGFCGSIGEVTEVRIMREKDSGDGKGYAFVTFRS 142 >At2g28910.1 68415.m03513 CAX-interacting protein 4 (CAXIP4) contains Pfam domain PF00098: Zinc knuckle; identical to cDNA CAX-interacting protein 4 GI:27651998 Length = 332 Score = 29.1 bits (62), Expect = 1.9 Identities = 16/60 (26%), Positives = 30/60 (50%) Frame = +2 Query: 155 DIENSEEFEVDEDGEQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDS 334 D ++S+E E ++D KEK R+R R +++ S+ + + R + +A DS Sbjct: 239 DEDDSDESEDEDDRRVKRKSRKEKRRRRSRRNHSDDSDSESSEDDRRQKRRNKVAASSDS 298 >At1g09890.1 68414.m01113 expressed protein ; expression supported by MPSS Length = 633 Score = 29.1 bits (62), Expect = 1.9 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +2 Query: 284 ERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHL 463 E NRG +D + G SGT G ++G V +EE E ++ E K + L Sbjct: 50 EEVNRGYWDLVW--GGSGTAGGFDVIKGSNFEVIVKNEEQIELSFTRKWDPSQEGKAVPL 107 Query: 464 NLDRRTGFLKG 496 N+D+R L G Sbjct: 108 NIDKRFVMLSG 118 >At5g48650.1 68418.m06016 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein Length = 458 Score = 28.7 bits (61), Expect = 2.5 Identities = 17/72 (23%), Positives = 35/72 (48%), Gaps = 2/72 (2%) Frame = +2 Query: 308 DSLAPEGDSGTPGPQRSV--EGWILFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRT 481 D+++ D+ G + EG ++V ++ A + ++ +F +FG I N + + + Sbjct: 297 DTVSESVDASENGHNQEAVAEGTSIYVRHLPFNANIDMLEAEFKQFGAITNGGIQVINQR 356 Query: 482 GFLKGYALVEYE 517 G Y VE+E Sbjct: 357 GLGYPYGFVEFE 368 >At2g09910.1 68415.m01029 hypothetical protein Length = 985 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/39 (33%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +2 Query: 182 VDEDGEQGIARLK--EKARKRKGRGFGNEAGGGSAAERG 292 VD+D ++ + L+ ++R+ KG+G N++ SA+E G Sbjct: 417 VDQDKDETVEELETSRRSREEKGKGVANQSKKRSASEAG 455 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEYET 520 +FV + EE+ ++ F FG ++ + D T +G+ V Y++ Sbjct: 122 IFVGGLSSNTTEEEFKSYFERFGRTTDVVVMHDGVTNRPRGFGFVTYDS 170 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 28.3 bits (60), Expect = 3.3 Identities = 11/47 (23%), Positives = 23/47 (48%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV ++ E + + FS F + + D++TG +G+ V + Sbjct: 146 IFVGDLSPEVTDATLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSF 192 >At2g34920.1 68415.m04287 ubiquitin-protein ligase-related contains weak similarity to Ubiquitin-protein ligase E3 Mdm2 (EC 6.3.2.-) (p53-binding protein Mdm2) (Oncoprotein Mdm2) (Double minute 2 protein) (Swiss-Prot:P23804) [Mus musculus] Length = 785 Score = 28.3 bits (60), Expect = 3.3 Identities = 24/87 (27%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Frame = +2 Query: 221 EKARKRKGRGFGNEAGGGSA-----AERGNRGRYDSLAPEGDSGTPGPQRSVEGWILFVS 385 EK R RKG F + GG S+ R NR + A S + SV+ L Sbjct: 202 EKPRTRKGNNFSDNLGGASSLVQIWEARLNRSNGGNSAIHSQSIEISSEASVQEIHLLAP 261 Query: 386 NVHEEAQEEDIQNQFSEFGEIKNIHLN 466 ++ E++ E+ + EI++ LN Sbjct: 262 SIDGESESENESKSPDQTVEIESGTLN 288 >At1g20760.1 68414.m02600 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 1019 Score = 28.3 bits (60), Expect = 3.3 Identities = 16/56 (28%), Positives = 26/56 (46%) Frame = +2 Query: 197 EQGIARLKEKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGTPGPQRSVE 364 ++G A E+ K + GFGNE + E+ + G ++ + SG P VE Sbjct: 691 QEGAALWDEEWDKFEDEGFGNEITFDKSKEQNSSGEKENGTVDDGSGPPDSPTHVE 746 >At5g64670.1 68418.m08127 ribosomal protein L15 family protein Length = 281 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 224 KARKRKGRGFGNEAGGGSAAERGNRGR 304 K + RKGRG G +G G A RG++G+ Sbjct: 76 KLKTRKGRGIG--SGKGKTAGRGHKGQ 100 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = +2 Query: 143 ADVLDIENSEEFEVDEDGEQGIARLKEKARKRKGR 247 ADV+D + +E+ E ++ E+ R KEK +K+ + Sbjct: 126 ADVVDEKVNEKLEAEQRSEERRERKKEKKKKKNNK 160 >At4g32720.1 68417.m04657 RNA recognition motif (RRM)-containing protein RNA-binding protein LAH1, Saccharomyces cerevisiae, PIR2:B48600; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 433 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/42 (26%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = +2 Query: 398 EAQEEDIQNQFSEFGEIKNIHLNLD-RRTGFLKGYALVEYET 520 + + ED+++ FS++G++ ++ + + G ALVE+ T Sbjct: 126 DVKREDVESFFSQYGKVNSVRMPRHVAESRIFSGVALVEFPT 167 Score = 27.5 bits (58), Expect = 5.8 Identities = 9/28 (32%), Positives = 18/28 (64%) Frame = +2 Query: 410 EDIQNQFSEFGEIKNIHLNLDRRTGFLK 493 ED++ F +FG++K + + TG+L+ Sbjct: 317 EDLKAVFGKFGDVKFVDFKMGSETGYLR 344 >At4g20730.1 68417.m03013 filament protein-related similar to Cytadherence high molecular weight protein 2 (SP:P47460) [Mycoplasma genitalium]; similar to YEAST NUF1 protein (Spindle poly body spacer protein SPC110) (SP:P32380) {Saccharomyces cerevisiae}; also SP|Q9UKX2|MYH2_HUMAN Myosin heavy chain, skeletal muscle, SP|P31732|OV71_ONCVO Muscle cell intermediate filament protein SP|P12882|MYH1_HUMAN Myosin heavy chain, skeletal muscle,. SP|Q17107|AV71_ACAVI Muscle cell intermediate filament protein Length = 800 Score = 27.9 bits (59), Expect = 4.4 Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 182 VDEDGEQGIARL--KEKARKRKGRGFGNEAGGGSAAERG 292 +DED ++ +A L ++R+ KG+G ++ SA+E G Sbjct: 452 LDEDKDETVAELGISRRSREEKGKGVATQSKKRSASEAG 490 >At2g30100.1 68415.m03663 ubiquitin family protein low similarity to SP|Q9UQ13 Leucine-rich repeat protein SHOC-2 (Ras-binding protein Sur-8) {Homo sapiens}; contains Pfam profiles PF00240: Ubiquitin family, PF01535: PPR repeat, PF00560: Leucine Rich Repeat Length = 897 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 197 EQGIARLKEKARKRKGRGFGNEAGGGSAAERG 292 E + +KE R+R G G+ GGGS +G Sbjct: 202 ESAVLFVKEVLRRRDGFGYSVVGGGGSEGRKG 233 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 27.9 bits (59), Expect = 4.4 Identities = 11/47 (23%), Positives = 24/47 (51%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFLKGYALVEY 514 +FV ++ E + + + FS F + + D++TG +G+ V + Sbjct: 150 IFVGDLSPEVTDAALFDSFSAFNSCSDARVMWDQKTGRSRGFGFVSF 196 >At1g29400.2 68414.m03597 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 490 LFV N++ ++ ++ F ++G+I+ ++ R GF+ Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHR-GFV 207 >At1g29400.1 68414.m03596 RNA recognition motif (RRM)-containing protein similar to GI:6650523 from [Arabidopsis thaliana] Length = 800 Score = 27.9 bits (59), Expect = 4.4 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIHLNLDRRTGFL 490 LFV N++ ++ ++ F ++G+I+ ++ R GF+ Sbjct: 170 LFVRNINSNVEDSELTALFEQYGDIRTLYTTCKHR-GFV 207 >At5g63180.1 68418.m07932 pectate lyase family protein similar to pectate lyase GP:14289169 from [Salix gilgiana] Length = 432 Score = 27.5 bits (58), Expect = 5.8 Identities = 26/89 (29%), Positives = 39/89 (43%), Gaps = 7/89 (7%) Frame = +2 Query: 221 EKARKRK---GRGFGNEAGGGSAAER---GNRGRYDSLAPEGDSGTPGPQRSVEGWILFV 382 EK RKR G GFG A GG E + G D + P + + WI+F Sbjct: 95 EKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFK 154 Query: 383 SNVHEEAQEEDIQNQFSEF-GEIKNIHLN 466 ++ + +EE I N F G ++H++ Sbjct: 155 RDMTIQLKEELIMNSFKTLDGRGASVHIS 183 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 374 LFVSNVHEEAQEEDIQNQFSEFGEIKNIH 460 LFV + E ++ FSEFG++ N H Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFGQVTNEH 88 >At4g32200.1 68417.m04582 DNA-binding HORMA domain-containing protein similar to meiotic asynaptic mutant 1 [Arabidopsis thaliana] GI:7939627, aysnaptic 1 [Brassica oleracea var. alboglabra] GI:23506946; contains Pfam profile PF02301: HORMA domain Length = 1399 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +2 Query: 182 VDEDGEQGIAR--LKEKARKRKGRGFGNEAGGGSAAERG 292 +D+D ++ +A + ++R+ KG+G N++ SA+E G Sbjct: 1044 LDQDKDETVAEPGISRRSREEKGKGGANQSKKRSASEAG 1082 >At3g62490.1 68416.m07021 expressed protein hypothetical proteins - Arabidopsis thaliana Length = 559 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/56 (26%), Positives = 31/56 (55%), Gaps = 7/56 (12%) Frame = +2 Query: 146 DVLDIENSEEFE-----VDEDGEQGIAR--LKEKARKRKGRGFGNEAGGGSAAERG 292 ++ + + SEE +D D ++ +A + ++R+ KG+G N++ SA+E G Sbjct: 232 EIAECDQSEEVNTGLTILDRDKDETVAEPGISRRSREEKGKGVANQSKKRSASEGG 287 >At3g61040.2 68416.m06831 cytochrome P450 family protein similar to cytochrome P450 monooxygenase - Arabidopsis thaliana, EMBL:D78600 Length = 395 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 424 ILYIFFLCFFMYITDKQNP 368 +L+IFFL FF Y T K P Sbjct: 10 LLFIFFLFFFFYTTGKSCP 28 >At3g61040.1 68416.m06830 cytochrome P450 family protein similar to cytochrome P450 monooxygenase - Arabidopsis thaliana, EMBL:D78600 Length = 498 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 424 ILYIFFLCFFMYITDKQNP 368 +L+IFFL FF Y T K P Sbjct: 10 LLFIFFLFFFFYTTGKSCP 28 >At2g17740.1 68415.m02055 DC1 domain-containing protein Length = 248 Score = 27.5 bits (58), Expect = 5.8 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +2 Query: 218 KEKARKRKGRGFGNEAG-GGSAAERGNRGRYDSLA 319 +E+ K+ GRG G E G GG+ RG LA Sbjct: 177 EEEKSKKGGRGRGGEGGSGGNGVNRGRSSANSELA 211 >At1g20220.1 68414.m02525 expressed protein Length = 315 Score = 27.5 bits (58), Expect = 5.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 179 EVDEDGEQGIARLKEKARKRKGRGFGNEAGG 271 E+D +G+ G R + R R GRG G GG Sbjct: 138 EIDYEGQDGSPRGRGGRRGRGGRGRGRGRGG 168 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%) Frame = +2 Query: 182 VDEDGEQGIARLKEKARKRKGRGFGNEAGGG----SAAERGNRGRYDSLAPEGDSGTPGP 349 +++D G R + + R GRG G G A + G Y+++AP D G GP Sbjct: 221 MEQDRSYGRGRGRGRGGGRGGRGRGGYNGPPPPYYEAQQDGGDYGYNNVAPPADHGYDGP 280 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 5/39 (12%) Frame = +2 Query: 242 GRGFGN--EAGGGSAAERGN---RGRYDSLAPEGDSGTP 343 GRGFG GGG + +RG RGR AP G G P Sbjct: 22 GRGFGGGRSFGGGRSGDRGRSGPRGRGRG-APRGRGGPP 59 >At5g10630.1 68418.m01231 elongation factor 1-alpha, putative / EF-1-alpha, putative contains similarity to SWISS-PROT:Q9YAV0 elongation factor 1-alpha (EF-1-alpha) [Aeropyrum pernix] Length = 667 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +2 Query: 269 GGSAAERGNRGRYDSLAPEGDSG 337 GG ++E +RGR+D L +G +G Sbjct: 138 GGDSSETSSRGRHDKLDDKGGAG 160 >At5g08660.1 68418.m01031 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 649 Score = 27.1 bits (57), Expect = 7.7 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +2 Query: 233 KRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSG--TPGPQRSVEGWILFVSNVHEEAQ 406 K G FG+E G S A+ G + P G + PG ++ L V +V E+ Q Sbjct: 7 KSLGINFGSEYSGSSVADDGREPDFGHSQPNGQTSLIVPGMRQ------LMVKDVKEQNQ 60 Query: 407 EEDI 418 +D+ Sbjct: 61 LKDV 64 >At3g27700.2 68416.m03459 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 908 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 374 LFVSNVHEEAQEED-IQNQFSEFGEIKNIHLNLDRRTGFLK 493 LFV+ V E+ D I F +FG++ +IH+ ++ F++ Sbjct: 440 LFVNYVPHESNRRDLILAHFQKFGKVIDIHIPVNSERAFVQ 480 >At3g27700.1 68416.m03458 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif Length = 908 Score = 27.1 bits (57), Expect = 7.7 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 374 LFVSNVHEEAQEED-IQNQFSEFGEIKNIHLNLDRRTGFLK 493 LFV+ V E+ D I F +FG++ +IH+ ++ F++ Sbjct: 440 LFVNYVPHESNRRDLILAHFQKFGKVIDIHIPVNSERAFVQ 480 >At1g79100.1 68414.m09223 arginine/serine-rich protein-related similar to arginine/serine-rich protein [Arabidopsis thaliana] GI:6601502 Length = 70 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +2 Query: 434 EFGEIKNIHLNLDRRTGFLKGYALVEYE 517 +FGEI ++ L +DR +G A VE++ Sbjct: 10 DFGEIIHVQLAIDRAANLSRGDAYVEFK 37 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 27.1 bits (57), Expect = 7.7 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 221 EKARKRKGRGFGNEAGGGSAAERGNRGRYDSLAPEGDSGT 340 +K R G G + GGG AE G RG +G T Sbjct: 277 DKTNGRGGEGREEDNGGGRGAEGGGRGSTGEGVTDGGGRT 316 >At1g13730.1 68414.m01612 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif (a.k.a. RRM, RBD, or RNP domain) Length = 428 Score = 27.1 bits (57), Expect = 7.7 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +2 Query: 353 RSVEGWILFVSNVHEEAQEEDIQNQFSEFGEI 448 + EG+ +FV+N+ +A E + F FG I Sbjct: 272 QQAEGYTIFVANLLMDATPEQLNETFKGFGAI 303 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,281,337 Number of Sequences: 28952 Number of extensions: 174036 Number of successful extensions: 1026 Number of sequences better than 10.0: 189 Number of HSP's better than 10.0 without gapping: 887 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1011 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -