BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS312B04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) 138 2e-33 SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) 29 3.1 SB_23672| Best HMM Match : PHD (HMM E-Value=0.00049) 28 4.1 SB_7532| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.4 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_53788| Best HMM Match : KH_1 (HMM E-Value=0) 27 9.4 SB_27239| Best HMM Match : Ion_trans (HMM E-Value=3.8e-39) 27 9.4 SB_5668| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 SB_48438| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.4 >SB_10518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 138 bits (335), Expect = 2e-33 Identities = 59/125 (47%), Positives = 93/125 (74%) Frame = +3 Query: 147 ISIRLKSVKNIQKITQSMKMVSAAKYTRAERDLKAARPYGEGAVQFYERAEVTPPEDDPK 326 +S+RL+SVKNIQKIT+SMKMVSAAK+ RAE++LK+AR YG+GA Y++ E+ +DPK Sbjct: 62 VSLRLRSVKNIQKITKSMKMVSAAKFGRAEKELKSARAYGDGATALYDKVEIKQESEDPK 121 Query: 327 QLFVAMTSDRGLCGAVHTGVSKVIRNRLSEPGAENIKVICVGDKSRGILQRLYGKHIISV 506 L V ++SDRGLCG +H+G++K ++ ++ + N+ ++ GDK++ IL R GK+++ Sbjct: 122 HLIVVLSSDRGLCGGIHSGLAKAVKASIAGNPSRNVGIVSFGDKTKQILSRTLGKNMLMS 181 Query: 507 ANEIG 521 ++G Sbjct: 182 FMDVG 186 >SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) Length = 1050 Score = 28.7 bits (61), Expect = 3.1 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = -1 Query: 209 HHLHGLCDFLDIFHRFKTDGNGLQSSHIPVWL 114 +H+ C+ + F+R + G G H+ VWL Sbjct: 595 NHIRNRCNVENFFYRIEFQGRGTAHVHLLVWL 626 >SB_23672| Best HMM Match : PHD (HMM E-Value=0.00049) Length = 370 Score = 28.3 bits (60), Expect = 4.1 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = -1 Query: 515 LISNTNDVLSVQSLQDTARFISHTDHLDVLSTRFAETVADHFRYTSVYSSAQTSVRGHSN 336 LI N DV +D+ + HTD+ V +R E V DH T+ + + S + S+ Sbjct: 62 LIRNNADVDEGME-EDSQMPLDHTDNTPVTHSREFEAVDDHTPPTTPTETTRKSAKRQSD 120 Query: 335 KQ 330 Q Sbjct: 121 SQ 122 >SB_7532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 291 RAEVTPPEDDPKQLFVAMTSDRGLCG 368 RA TPPE K + + S GLCG Sbjct: 263 RARATPPEVTDKMAILRLPSGLGLCG 288 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 27.5 bits (58), Expect = 7.1 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = -3 Query: 288 HRTVLHLHHRDEQLSGHAQHGC 223 +R LH+ H +++L H H C Sbjct: 1068 NRNTLHVKHANQRLGSHGNHSC 1089 >SB_53788| Best HMM Match : KH_1 (HMM E-Value=0) Length = 356 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/67 (29%), Positives = 31/67 (46%), Gaps = 1/67 (1%) Frame = -1 Query: 398 DHFRYTSV-YSSAQTSVRGHSNKQLLGVIFGRCNLSPFIELYCTFTIGTSSFQVTLSTGV 222 +H Y ++ YS TS GH+N QL G F + PF L +G ++ +T Sbjct: 177 EHALYNNIMYSGLTTSRAGHTNGQLAGSAFS--SGLPFSALSGLSALGLTNTATAQNTTT 234 Query: 221 FSS*HHL 201 ++ H L Sbjct: 235 SATNHIL 241 >SB_27239| Best HMM Match : Ion_trans (HMM E-Value=3.8e-39) Length = 307 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -2 Query: 424 APGSLRRLRITLDTPVCTAPHKPLSEVI 341 +PG LR LR+T PVC A + L +I Sbjct: 103 SPGLLRVLRVTKGGPVCQANRQLLVAII 130 >SB_5668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 65 TLRTGCGHPSRGGGLPSAKQEYGYFEGHFH 154 T T HPS+G G E GY +G H Sbjct: 20 TQSTCAPHPSKGVGCTGVADEGGYLKGQCH 49 >SB_48438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 27.1 bits (57), Expect = 9.4 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +1 Query: 79 VWAPKSWRWFTISQTGIWL 135 VW + W W+T++ +W+ Sbjct: 54 VWYQEKWEWYTLNNRRLWV 72 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,359,712 Number of Sequences: 59808 Number of extensions: 410100 Number of successful extensions: 1094 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1007 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1093 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -