BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311H07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58701| Best HMM Match : bZIP_2 (HMM E-Value=1.6) 32 0.33 SB_35019| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) 27 7.1 SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) 27 9.4 SB_55784| Best HMM Match : CUB (HMM E-Value=3.1e-25) 27 9.4 >SB_58701| Best HMM Match : bZIP_2 (HMM E-Value=1.6) Length = 940 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/58 (24%), Positives = 33/58 (56%) Frame = -3 Query: 468 TKLTNVSTYKSDAGVETIKLELQENLISWISNGVC*INQKRLPYNRLTLTVPRHLVRT 295 TKL+++ + +SDA + ++ L +Q N + +S NQ ++ + +P++ +R+ Sbjct: 219 TKLSDLGSIRSDANLHSMDLAIQSNTVDGLSAQASGGNQNSYAFSCFSCEIPQNSLRS 276 >SB_35019| Best HMM Match : 7tm_1 (HMM E-Value=4.2039e-45) Length = 412 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 260 FSVMTILKLMRSRKPTNIFLKKTIIFDSLV 171 F V TI K+ R + PTN+ +FD +V Sbjct: 56 FVVRTIFKVPRMKTPTNMMFVNMALFDIIV 85 >SB_58590| Best HMM Match : Polysacc_deac_1 (HMM E-Value=2.6e-08) Length = 893 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = -3 Query: 276 LTESKVFGDDDIEVNEVKKTDKYLFKKN 193 LTE V GD V K D YLFK+N Sbjct: 100 LTEEDVLGDVASNVATHKARDVYLFKRN 127 >SB_55784| Best HMM Match : CUB (HMM E-Value=3.1e-25) Length = 418 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/38 (34%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +2 Query: 56 RTVSGCGVSGELFWSFNS-LIRIHFNSTPDSKSICMYF 166 R + G + +L SF++ L+ HF+ + DS S+C+ F Sbjct: 3 RIIFQSGFNNKLTQSFSAKLVGPHFSRSVDSSSVCLRF 40 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,863,065 Number of Sequences: 59808 Number of extensions: 247544 Number of successful extensions: 459 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -