BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS311G07f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 3.6 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 4.7 AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 23 6.2 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 23 6.2 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 6.2 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 125 RRHCVQSRSASLPTRLSLGP*RQIHLFCLHSMLSHGNI 12 ++H QS PT L LG + LH S GN+ Sbjct: 735 QQHVQQSGGVERPTNLDLGTGKYESNLLLHEPHSVGNV 772 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 23.4 bits (48), Expect = 4.7 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 115 QCLRDRACYGSKKVYLSSRTKRKSRR 192 +CL+D YG K + R+ RR Sbjct: 308 ECLKDHCAYGGKTCVCCIESFRRRRR 333 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 238 EHAMGTKTVICLGETRLSRVGKLALYF 318 EH G T+I + VG++ LYF Sbjct: 288 EHPEGRTTLIVQAASYAKYVGRITLYF 314 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 23.0 bits (47), Expect = 6.2 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +1 Query: 238 EHAMGTKTVICLGETRLSRVGKLALYF 318 EH G T+I + VG++ LYF Sbjct: 288 EHPEGRTTLIVQAASYAKYVGRITLYF 314 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 305 SLPTRLNLVSPRQITVFVPIA 243 ++P ++V P+ TVF+PIA Sbjct: 412 TIPGDPDIVIPKGATVFIPIA 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 568,360 Number of Sequences: 2352 Number of extensions: 12305 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -