BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C11f (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 35 0.001 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 30 0.028 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 30 0.028 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 30 0.037 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 29 0.065 AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein p... 29 0.086 AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein p... 28 0.11 AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein p... 28 0.15 AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein p... 27 0.20 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 27 0.26 AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein p... 27 0.35 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 27 0.35 AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein p... 25 0.80 AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein p... 25 1.1 AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakini... 25 1.4 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 3.2 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 4.3 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 5.7 AY842257-1|AAW29520.1| 92|Anopheles gambiae glutathione peroxi... 22 9.9 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 35.1 bits (77), Expect = 0.001 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECK 69 +RC +CLE GHW+++C+ Sbjct: 660 VRCYRCLELGHWAHDCR 676 Score = 27.1 bits (57), Expect = 0.26 Identities = 14/40 (35%), Positives = 19/40 (47%) Frame = +3 Query: 66 QGQTQDPSSSFTYTNHA*ESESQRRRSMQQWQLQDTQQEK 185 Q Q Q +T SQR+R +QQ Q Q QQ++ Sbjct: 408 QQQQQQQPQQLLWTTVVRSCPSQRQRQLQQQQQQQQQQQQ 447 Score = 25.0 bits (52), Expect = 1.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 120 ESESQRRRSMQQWQLQDTQQEK 185 + + Q ++ QQWQ Q QQ++ Sbjct: 357 QQQQQHQQQQQQWQQQQQQQQQ 378 Score = 23.0 bits (47), Expect = 4.3 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +3 Query: 66 QGQTQDPSSSFTYTNHA*ESESQRRRSMQQWQLQDTQQEK 185 Q Q Q P S + S R + QQ Q Q QQ++ Sbjct: 373 QQQQQQPRQSLPHRKQTQLQLSPRLQQQQQQQQQSQQQQQ 412 Score = 22.6 bits (46), Expect = 5.7 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = +3 Query: 120 ESESQRRRSMQQWQLQDTQQE 182 + + QR++ QQ QLQ QQ+ Sbjct: 213 QCQQQRQQQPQQQQLQQPQQQ 233 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 30.3 bits (65), Expect = 0.028 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 22 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCS 153 +C +C E+GH + C GK R+ H+ + K EG C+ Sbjct: 213 QCYRCYEYGHTAARCHGK-------DRSSKCHRCAEDKHEGPCT 249 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 30.3 bits (65), Expect = 0.028 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = +1 Query: 22 RCQKCLEFGHWSYECKG 72 RC KC E GH+S +CKG Sbjct: 417 RCFKCWETGHFSRDCKG 433 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 29.9 bits (64), Expect = 0.037 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%) Frame = +1 Query: 10 PQGIRCQKCLEFGHWSYECKG---KRKILVRPSRTRIMHKNLKAKEEGQCS 153 P+ RC +CLE GH + C+ ++ + +R T HK + E +C+ Sbjct: 503 PERQRCFRCLEMGHIASNCRSTADRQNLCIRCGLTG--HKARSCQNEAKCA 551 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 29.1 bits (62), Expect = 0.065 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKG---KRKILVRPSRTRIMHKNLKAKEEGQCSNGSCKIPN 177 +RC +CLE GH + +C+ ++ + +R + HK EE +C G C P+ Sbjct: 549 LRCYRCLEHGHNARDCRSPVDRQNVCIRCGQEG--HKAGTCMEEIRC--GKCDGPH 600 Score = 23.4 bits (48), Expect = 3.2 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 120 ESESQRRRSMQQWQLQDTQQE 182 + + Q+R ++WQ Q QQ+ Sbjct: 248 QQQQQQRNQQREWQQQQQQQQ 268 >AB090812-1|BAC57899.1| 541|Anopheles gambiae gag-like protein protein. Length = 541 Score = 28.7 bits (61), Expect = 0.086 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 4 AFPQGIRCQKCLEFGHWSYECK 69 A P+ RC +CLE GH ++ C+ Sbjct: 470 AAPERQRCYRCLERGHLAHACR 491 >AB090824-1|BAC57923.1| 298|Anopheles gambiae gag-like protein protein. Length = 298 Score = 28.3 bits (60), Expect = 0.11 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = +1 Query: 22 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQC 150 RC +CLE GH EC+G + + HK + + +C Sbjct: 235 RCFRCLERGHMVRECQGTNRSSLCIRCGAANHKAVNCTNDVKC 277 >AB090821-1|BAC57917.1| 353|Anopheles gambiae gag-like protein protein. Length = 353 Score = 27.9 bits (59), Expect = 0.15 Identities = 9/19 (47%), Positives = 14/19 (73%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC +CLE GH + +C G+ Sbjct: 289 VRCFRCLERGHTTADCAGE 307 >AB090819-1|BAC57913.1| 400|Anopheles gambiae gag-like protein protein. Length = 400 Score = 27.5 bits (58), Expect = 0.20 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 ++C KC + GH +EC G+ Sbjct: 328 VKCFKCWKLGHKGFECTGQ 346 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 27.1 bits (57), Expect = 0.26 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 22 RCQKCLEFGHWSYECKGKRKILVRPSRTRIMHK-NLKAKEEGQCSN 156 +C KC + GH SY C+ P R+ + K L ++ C+N Sbjct: 276 KCYKCWKVGHTSYHCR-------EPDRSNLCWKCGLSGHKKQACTN 314 >AB090823-1|BAC57921.1| 429|Anopheles gambiae gag-like protein protein. Length = 429 Score = 26.6 bits (56), Expect = 0.35 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 22 RCQKCLEFGHWSYECK 69 RC +CLE GH + EC+ Sbjct: 363 RCYRCLERGHIARECR 378 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 26.6 bits (56), Expect = 0.35 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 19 IRCQKCLEFGHWSYEC 66 +RC +CLE GH S +C Sbjct: 404 LRCYRCLERGHVSRDC 419 >AB090816-1|BAC57907.1| 455|Anopheles gambiae gag-like protein protein. Length = 455 Score = 25.4 bits (53), Expect = 0.80 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 22 RCQKCLEFGHWSYECK 69 RC +CLE GH + +C+ Sbjct: 389 RCYRCLERGHLARDCQ 404 Score = 23.4 bits (48), Expect = 3.2 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +3 Query: 120 ESESQRRRSMQQWQLQDTQQEK 185 + Q++RS+QQ Q Q QQ++ Sbjct: 183 QQREQQQRSLQQQQQQQQQQQQ 204 >AB090820-1|BAC57915.1| 527|Anopheles gambiae gag-like protein protein. Length = 527 Score = 25.0 bits (52), Expect = 1.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 22 RCQKCLEFGHWSYECKGK 75 RC +CLE GH + C G+ Sbjct: 465 RCFRCLERGHIAATCTGE 482 >AY347952-1|AAR28375.1| 634|Anopheles gambiae putative sulfakinin GPCR protein. Length = 634 Score = 24.6 bits (51), Expect = 1.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 316 SLNQTRSPIHCCCHYQTSSNPPM 248 S + R PI CCC SSN PM Sbjct: 539 SCYRNRMPI-CCCFCCASSNGPM 560 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.4 bits (48), Expect = 3.2 Identities = 6/13 (46%), Positives = 10/13 (76%) Frame = -3 Query: 298 SPIHCCCHYQTSS 260 S I+CCCH+ ++ Sbjct: 145 SKIYCCCHFSMAT 157 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.0 bits (47), Expect = 4.3 Identities = 8/22 (36%), Positives = 16/22 (72%) Frame = +3 Query: 120 ESESQRRRSMQQWQLQDTQQEK 185 + + Q+++S+QQ QL QQ++ Sbjct: 242 QQQQQQQQSLQQQQLSQQQQQQ 263 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 22.6 bits (46), Expect = 5.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = +1 Query: 79 KILVRPSRTRIMHKNLKAKEEGQCSNGSCKI 171 +I P + I H+++K+K NG C I Sbjct: 373 EIFGTPGKPSIAHRDIKSKNILVKRNGQCAI 403 >AY842257-1|AAW29520.1| 92|Anopheles gambiae glutathione peroxidase protein. Length = 92 Score = 21.8 bits (44), Expect = 9.9 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 79 KILVRPSRTRIMHKNLKAKEEGQC 150 +I V S+ ++K LKAK+ G C Sbjct: 55 EIEVNGSKAPGLYKYLKAKKPGNC 78 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 307,994 Number of Sequences: 2352 Number of extensions: 4896 Number of successful extensions: 38 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -