BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30731 (426 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24591| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 3e-07 SB_13925| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 3e-06 SB_24775| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 29 1.2 SB_40870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.1 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.8 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) 27 4.9 SB_49189| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.5 SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_22899| Best HMM Match : Glyco_transf_8 (HMM E-Value=9.5e-15) 27 8.6 >SB_24591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 51.2 bits (117), Expect = 3e-07 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +2 Query: 89 STAKMPPTDFVPRPYTGPSYQQVEQMKGVYMPPSITNAYKKPVLLTQGHMQWLYD 253 ST +MPP D+ P PY G S+ + +Q++ Y+ P++ YK P+ + +W+ D Sbjct: 31 STLEMPPCDYKPEPYKGMSFDKAKQIRQTYLNPALLAYYKDPIFIWAVITKWIQD 85 >SB_13925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/56 (35%), Positives = 33/56 (58%) Frame = +2 Query: 245 LYDNDGKRYLDLFGGIVTVSVGHCHPKVNAALKDQLDVLWHTTNLYRHPKIYEYVE 412 ++D GKRY+D V+ GHCHP++ AL+DQ +L T+ + + + E+ E Sbjct: 1 MWDVTGKRYIDFLAAYSAVNQGHCHPRIVKALQDQAGILSLTSRAFYNDVLGEFQE 56 >SB_24775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 35.5 bits (78), Expect = 0.019 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +2 Query: 242 WLYDNDGKRYLDLFGGIVTVSVGHCHPKVNAALKDQL 352 ++ D D KRY+D G + +GH HP+V A+++QL Sbjct: 43 YVTDEDDKRYVDYVGSWGPMILGHSHPEVLDAVRNQL 79 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 29.5 bits (63), Expect = 1.2 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 39 KWLIEEQNYASTSSERTARPKCRRRISCPDRTRDLRTNK 155 KWL ++N A SS T K + S PD T+ NK Sbjct: 716 KWLQSQKNQAPNSSSETKDSKWPQAPSIPDNTQTNEPNK 754 >SB_40870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.7 bits (61), Expect = 2.1 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 242 WLYDNDGKRYLDLFGGIVTVSVGHCHPKVNAALKD 346 ++ D DG LD++ I ++ +G+ HP + A++D Sbjct: 157 YVVDADGNVMLDVYQQIASIPLGYNHPALLKAMQD 191 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.7 bits (61), Expect = 2.1 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = +3 Query: 21 QQRNTSKWLIEEQNYASTSSERTARPKCRRRISCPDRTRDLRTNK*NK*KEFTCRLQ 191 ++ L+EEQ S S T R C S +RT D N+ KE C+L+ Sbjct: 1355 EEMKNESMLVEEQLNESQSELETTRESCTSMNSDLERTCDELQIAQNELKELRCQLE 1411 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 28.3 bits (60), Expect = 2.8 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 215 VLLTQGHMQWLYDNDGKRYLDLFGGIVTVSVGHCHPK 325 VLLT G Q L KR D IV+V VG C+ K Sbjct: 4068 VLLTDGQSQDLVFTAAKRLRDAGVTIVSVGVGCCYSK 4104 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.9 bits (59), Expect = 3.7 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 133 HGTFVPTSRTNERSLHAAFNHERL*EAGASHPGAHAVVIRQRRQEIPGSVRWNRHRLRGP 312 HG + PT T+ L+A+ + AG+ HP HAV + +P + W LR P Sbjct: 495 HGMY-PTVPTSSALLNASA--VPVPGAGSPHPHYHAVQGANGQYSVPCNCTWQPQDLRRP 551 Query: 313 LS 318 ++ Sbjct: 552 VA 553 >SB_5388| Best HMM Match : PH (HMM E-Value=2.5e-08) Length = 293 Score = 27.5 bits (58), Expect = 4.9 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +2 Query: 104 PPTDFVPRPYTGPSYQQVEQMKGVYMPPSITNAYKKPVLLTQGH 235 PPT + P+PY Y Q +G Y P AY +P QG+ Sbjct: 154 PPTSYPPQPYPAQPYPQ----QG-YPPQPPPQAYPQPGYPPQGY 192 >SB_49189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1373 Score = 27.1 bits (57), Expect = 6.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 253 QRRQEIPGSVRWNRHRLRGPLSSESKCSPQR 345 +R QE+ G V +R + P +SES+C R Sbjct: 30 ERVQELQGVVTTDRETIDDPNTSESRCQENR 60 >SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 26.6 bits (56), Expect = 8.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 221 LTQGHMQWLYDNDGKRY 271 L QG+M W ++N GK Y Sbjct: 670 LAQGNMTWCWENRGKEY 686 >SB_22899| Best HMM Match : Glyco_transf_8 (HMM E-Value=9.5e-15) Length = 847 Score = 26.6 bits (56), Expect = 8.6 Identities = 15/61 (24%), Positives = 28/61 (45%) Frame = +2 Query: 38 EMANRGTKLCFDIVRTYSTAKMPPTDFVPRPYTGPSYQQVEQMKGVYMPPSITNAYKKPV 217 E +R + F + +ST + P+ P PY +YQQ+ + +G P + + + Sbjct: 786 EHKDRPNDVTFGCFQHFSTISLMPS---PLPYVMQNYQQLGESEGSLTPEGLISKLRSCT 842 Query: 218 L 220 L Sbjct: 843 L 843 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,782,839 Number of Sequences: 59808 Number of extensions: 372400 Number of successful extensions: 1098 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1032 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1098 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 814166562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -