BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30721 (719 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 23 1.9 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 4.4 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 7.6 AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory recept... 21 7.6 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 23.4 bits (48), Expect = 1.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 152 RFVHFNNERMLLSVGTPVPRERYLHNNSFVS 244 R V FN++++ L TP P R L +SFV+ Sbjct: 104 RAVTFNHQQLELETDTPEP-ARTLLEHSFVA 133 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = +3 Query: 363 MENSFEYDTTTSP 401 ++N+FEYDT + P Sbjct: 61 IQNNFEYDTASLP 73 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 7.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +1 Query: 676 RCFRLRRVEVVYC 714 +C+ LRR+ YC Sbjct: 49 KCYNLRRIYYFYC 61 >AM292322-1|CAL23134.1| 373|Tribolium castaneum gustatory receptor candidate 1 protein. Length = 373 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -3 Query: 543 IVYCTMTFFLFKHTETE 493 +VYC++TFF T+ Sbjct: 50 LVYCSVTFFALSELLTD 66 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,890 Number of Sequences: 336 Number of extensions: 3361 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -