BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30720 (672 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 44 0.003 UniRef50_A5DZS3 Cluster: Putative uncharacterized protein; n=1; ... 33 8.3 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 44.0 bits (99), Expect = 0.003 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +3 Query: 42 RWVDELTVHLVLSGYWSP 95 RWVDELT HLVLSGYWSP Sbjct: 158 RWVDELTAHLVLSGYWSP 175 >UniRef50_A5DZS3 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 765 Score = 32.7 bits (71), Expect = 8.3 Identities = 17/50 (34%), Positives = 23/50 (46%) Frame = +2 Query: 113 NAPPTLRYKF*GLSIVTTAAPPFKPK*ITK*AGYIPVRTHKRSYHQ*VWN 262 ++P Y+F A PPF+P TK Y TH S H+ +WN Sbjct: 602 HSPSEALYQFGAEQNNIAARPPFEPYDATKTYHYYNYETHDTSDHELIWN 651 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 619,960,740 Number of Sequences: 1657284 Number of extensions: 11689886 Number of successful extensions: 19338 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18931 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19336 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 51652897375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -