BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30719 (730 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 30 1.8 At5g49150.1 68418.m06083 hypothetical protein 28 5.5 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 29.9 bits (64), Expect = 1.8 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 5/47 (10%) Frame = +3 Query: 300 ASQKIVDFFHNFAEKYFWH---NFSKLV--NYRVNLIVLPTNLIDPL 425 A QK+VDFF + E++F H F K++ +YR+N L N + PL Sbjct: 1244 AIQKLVDFFQSCPERHFVHILEPFLKIITKSYRINK-TLAVNGLTPL 1289 >At5g49150.1 68418.m06083 hypothetical protein Length = 896 Score = 28.3 bits (60), Expect = 5.5 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 220 PFSIDNALSIWRS*NVIFAIVCDLTILLHRK 312 P + N +SIW+S + I + ILLH+K Sbjct: 113 PLDVSNCVSIWKSELSTWQIFSKMEILLHQK 143 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,141,412 Number of Sequences: 28952 Number of extensions: 270753 Number of successful extensions: 499 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 499 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1594686376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -