BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30712 (803 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7JS72 Cluster: Possible type IV site-specific deoxyrib... 35 2.8 UniRef50_Q9Y012 Cluster: Serine/threonine protein kinase, putati... 34 4.8 UniRef50_Q6FC92 Cluster: Putative uncharacterized protein; n=1; ... 33 8.4 >UniRef50_A7JS72 Cluster: Possible type IV site-specific deoxyribonuclease, methyltransferase and restriction subunits; n=1; Mannheimia haemolytica PHL213|Rep: Possible type IV site-specific deoxyribonuclease, methyltransferase and restriction subunits - Mannheimia haemolytica PHL213 Length = 1000 Score = 34.7 bits (76), Expect = 2.8 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +3 Query: 543 NVDSIFDIFFQIMRFTNYSTSPYINTRGDLTIVQTTW-HTGCLKQQAILELYQRFQISNI 719 N D I F I R +Y+ + Y + D I Q+ + C +LE+YQR Q + Sbjct: 356 NRDIISTPNFIIRRIIDYTVNEYCKGKNDSNIYQSKFADIACGSGAFLLEVYQRLQDILV 415 Query: 720 DYY 728 DYY Sbjct: 416 DYY 418 >UniRef50_Q9Y012 Cluster: Serine/threonine protein kinase, putative; n=1; Plasmodium falciparum 3D7|Rep: Serine/threonine protein kinase, putative - Plasmodium falciparum (isolate 3D7) Length = 587 Score = 33.9 bits (74), Expect = 4.8 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -1 Query: 563 IEY*INIS-KSFLIYHSQTFREH*Y*NYNALRLFGRSEPYFLCNFNFMSENQY 408 I Y +N++ K LIY S+ +E+ Y NY + + YFLC FN S + Y Sbjct: 5 ILYDLNLTPKKNLIYKSKYIKEYTY-NYFNYVISNKEPKYFLCTFNHTSVSSY 56 >UniRef50_Q6FC92 Cluster: Putative uncharacterized protein; n=1; Acinetobacter sp. ADP1|Rep: Putative uncharacterized protein - Acinetobacter sp. (strain ADP1) Length = 436 Score = 33.1 bits (72), Expect = 8.4 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 600 TSPYINTRGDLTIVQTTWHTGCLKQQAILELYQRFQISNIDYY 728 TSP N +G +V TW G + +L+Q FQ + ID Y Sbjct: 236 TSPS-NLKGQAGVVSVTWENGLRPYAEMQDLFQAFQNNGIDVY 277 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 696,857,233 Number of Sequences: 1657284 Number of extensions: 13161543 Number of successful extensions: 24717 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 23812 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24713 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 69143070360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -