BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30712 (803 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 27 0.23 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 27 0.23 AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochr... 23 3.8 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 26.6 bits (56), Expect = 0.23 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 594 YSTSPYINTRGDLTIVQTTWHTGCLKQQAILELYQR 701 Y + I D ++TTW LK+ +LEL++R Sbjct: 74 YKNTYLIILFADFAYLETTWICTLLKKDKLLELFKR 109 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 26.6 bits (56), Expect = 0.23 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 594 YSTSPYINTRGDLTIVQTTWHTGCLKQQAILELYQR 701 Y + I D ++TTW LK+ +LEL++R Sbjct: 92 YKNTYLIILFADFAYLETTWICTLLKKDKLLELFKR 127 >AF264720-1|AAF75272.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q1 protein. Length = 126 Score = 22.6 bits (46), Expect = 3.8 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 616 IQEVT*QLSKLPGTQDASSSKQYLNCIKD 702 ++EV LSK P D + K CIK+ Sbjct: 26 MREVLGDLSKKPSYNDLQNLKYLERCIKE 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,816 Number of Sequences: 336 Number of extensions: 3823 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21895259 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -