BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30710 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7201| Best HMM Match : ketoacyl-synt (HMM E-Value=0) 31 1.2 SB_59696| Best HMM Match : Flagellin_IN (HMM E-Value=7.4) 28 8.6 >SB_7201| Best HMM Match : ketoacyl-synt (HMM E-Value=0) Length = 1821 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 336 LWIDPMAKRSRWRSLTRWEEDLSWPNLDRRNTGYR 232 L + P S +R++ +W + WP ++R+T YR Sbjct: 1555 LLVVPQETTSVYRAVKKWNSEEKWPQQEKRSTIYR 1589 >SB_59696| Best HMM Match : Flagellin_IN (HMM E-Value=7.4) Length = 126 Score = 27.9 bits (59), Expect = 8.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -3 Query: 357 FNNDCLSLWIDPMAKRSRWRSLTRWEEDLSWPNLDRRN 244 F D L+L+ + +R R+ L +W SW NL+R + Sbjct: 8 FTGDELTLFFEQPIRRPRFVVLRQWSLFNSWYNLEREH 45 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,564,193 Number of Sequences: 59808 Number of extensions: 411524 Number of successful extensions: 854 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 853 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -