BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30708 (734 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 26 1.1 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 24 5.6 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 24 5.6 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 26.2 bits (55), Expect = 1.1 Identities = 13/25 (52%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -1 Query: 83 ALYLS-HNVIRFCIYSGHGFISETA 12 AL LS HNV+R+ I GH S +A Sbjct: 187 ALTLSDHNVVRYAIIQGHRLTSSSA 211 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 340 HSSAHMLGEAMERVYGGCLCYGPPIEEGFYYDMY 441 H + + EA +R+YG + G E YY Y Sbjct: 409 HLNNEHVFEAFDRIYGNKINIGNTYAEEHYYRRY 442 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.8 bits (49), Expect = 5.6 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 340 HSSAHMLGEAMERVYGGCLCYGPPIEEGFYYDMY 441 H + + EA +R+YG + G E YY Y Sbjct: 409 HLNNEHVFEAFDRIYGNKINIGNTYAEEHYYRRY 442 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.317 0.135 0.421 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 779,548 Number of Sequences: 2352 Number of extensions: 16513 Number of successful extensions: 30 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -