BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30702 (804 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease pr... 25 2.7 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 4.8 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 24 4.8 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 24 4.8 EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 24 6.3 DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. 23 8.3 >AJ276487-1|CAB90819.1| 375|Anopheles gambiae serine protease protein. Length = 375 Score = 25.0 bits (52), Expect = 2.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 331 CPPPSRGAGRCLRIYTCLVRVDAAR 257 C P+ AGRC+R+ C +D R Sbjct: 30 CTTPNGTAGRCVRVRECGYVLDLLR 54 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 36 HASTSEQSTCLCGPPPPTQARGVW 107 HA T+ + PPPPT VW Sbjct: 199 HAPTTTTTWSDLPPPPPTTTTTVW 222 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 36 HASTSEQSTCLCGPPPPTQARGVW 107 HA T+ + PPPPT VW Sbjct: 199 HAPTTTTTWSDLPPPPPTTTTTVW 222 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 24.2 bits (50), Expect = 4.8 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +3 Query: 36 HASTSEQSTCLCGPPPPTQARGVW 107 HA T+ + PPPPT VW Sbjct: 199 HAPTTTTTWSDLPPPPPTTTTTVW 222 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.8 bits (49), Expect = 6.3 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 24 LSVQHASTSEQSTCLCGPPPPT 89 L Q AS S + GPPPPT Sbjct: 438 LPSQEASPSGEQPGRMGPPPPT 459 >DQ974172-1|ABJ52812.1| 409|Anopheles gambiae serpin 13 protein. Length = 409 Score = 23.4 bits (48), Expect = 8.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 669 LTLLFLSYRPSHTPIHVFFGRPLPPIPCTTISIHLLVT*ISSL 797 L L+ S + + VFF +P P +T+ HL ISS+ Sbjct: 201 LDATILALPGSTSNVSVFFLKPSPDTDVSTLETHLRNQSISSV 243 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 914,284 Number of Sequences: 2352 Number of extensions: 21148 Number of successful extensions: 87 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 87 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 84823812 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -