BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30701 (542 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) 32 0.35 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.9 SB_19791| Best HMM Match : Reprolysin (HMM E-Value=3.1) 29 1.9 SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) 28 4.3 SB_5142| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) 27 7.5 SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) 27 9.9 SB_30084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_29012| Best HMM Match : Avirulence (HMM E-Value=1.1) Length = 444 Score = 31.9 bits (69), Expect = 0.35 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 94 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 207 +T+R V+T P L + RLH H +HC L +R V Sbjct: 370 QTVRIVQTPPDRLCALYRLHHTHSAHCTDTTRLTVRTV 407 Score = 29.1 bits (62), Expect = 2.5 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 94 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 207 +TLR V+T P L + R H+ H +HC +R V Sbjct: 210 QTLRIVQTPPDRLCALYRFHQTHCAHCTDFTRQTVRTV 247 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = -2 Query: 208 QRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVDVQMCPAVHXXXXXXXXX 29 Q G R E R + F QT ++L P++A+CV+ D + A+H Sbjct: 156 QSSGMRRLEEERVL---FLETDTQTDMLLG-KPKSAICVQRFDDSLNSAIHTTYRTWLRS 211 Query: 28 XXXREPSDP 2 EP DP Sbjct: 212 SSMHEPRDP 220 >SB_49656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 292 Score = 29.5 bits (63), Expect = 1.9 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = -2 Query: 208 QRDGSRARHEPRNVINVFYAAGPQTGVVLDVSPRTAMCVRNVDVQMCPAVHXXXXXXXXX 29 Q G R E R + F QT ++L P++A+CV+ D + A+H Sbjct: 65 QSSGMRRLEEERVL---FLETDTQTDMLLG-KPKSAICVQRFDDSLNSAIHTTYRTWLRS 120 Query: 28 XXXREPSDP 2 EP DP Sbjct: 121 SSMHEPRDP 129 >SB_19791| Best HMM Match : Reprolysin (HMM E-Value=3.1) Length = 616 Score = 29.5 bits (63), Expect = 1.9 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 330 MFYCYFKIFIITSNLSGARVMFSVRVASSRVYEFLSSWFR 449 + +C K+F+I SNL ++ + ++SR S WF+ Sbjct: 147 LVFCLTKVFLIESNLPALDIVKNKIDSASRYLHVFSKWFQ 186 >SB_37790| Best HMM Match : HAT (HMM E-Value=0.17) Length = 498 Score = 28.3 bits (60), Expect = 4.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 74 LNIDISNAHCGPWRHIQDHSCLRAGCIKN 160 L +D+ NA GPW I+ H C + C+ N Sbjct: 287 LKLDMGNA--GPWGDIKIHPCDKPKCLTN 313 >SB_5142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 27.9 bits (59), Expect = 5.7 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +2 Query: 107 PWRHIQDHSCLRAGCIKNI 163 PWR+ DH CL+ I N+ Sbjct: 5 PWRNAADHHCLKTAIIFNV 23 >SB_5689| Best HMM Match : Ribosomal_L34e (HMM E-Value=0.34) Length = 524 Score = 27.5 bits (58), Expect = 7.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 94 RTLRSVETHPGPLLSEGRLHKKH*SHCVARAALVIRRV 207 +T+R+V+T P L + R H+ +HC +R V Sbjct: 365 QTVRTVQTSPDRLCALYRFHQTDCAHCTVTTRQTVRSV 402 >SB_32407| Best HMM Match : WSC (HMM E-Value=0.0008) Length = 832 Score = 27.1 bits (57), Expect = 9.9 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = -1 Query: 524 LQRFASHRRRRRILNND*YNVNNRITKPRRQKFIYTRTRYAHAKHNARAREVRRDY 357 LQR +RR+R+ + R + +RQ+++ R H KH R + +R + Sbjct: 207 LQRRLERKRRQRLRRQE---RRKRHLERQRQRYLEKLRRLKHEKHLRRLKRLREQW 259 >SB_30084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.1 bits (57), Expect = 9.9 Identities = 13/45 (28%), Positives = 20/45 (44%) Frame = +2 Query: 272 PKTTITNRVSLARLSDGSKNVLLLFQNFHNHVEPLWRARYV*RAR 406 P + + N L DG ++ + N VEPLW +V A+ Sbjct: 17 PNSPVQNGTLKQSLEDGKDHMSTCYDWSRNEVEPLWLYEHVEAAK 61 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,114,960 Number of Sequences: 59808 Number of extensions: 287185 Number of successful extensions: 844 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1239956166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -