BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30700 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding pr... 23 6.9 AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltr... 23 6.9 >AY146746-1|AAO12061.1| 333|Anopheles gambiae odorant-binding protein AgamOBP43 protein. Length = 333 Score = 23.4 bits (48), Expect = 6.9 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -2 Query: 187 HRSFNCLTYHYRYSR 143 HRSF C HY Y R Sbjct: 137 HRSFLCYHQHYGYLR 151 >AJ439060-14|CAD27765.1| 471|Anopheles gambiae putative acetyltransferase protein. Length = 471 Score = 23.4 bits (48), Expect = 6.9 Identities = 13/42 (30%), Positives = 19/42 (45%) Frame = +1 Query: 37 IESV*LLFEQYLRVYGRHLFDYLPSEFYLMSNIRHSYYNDSG 162 +ESV + + R G HL + + +M NI H Y G Sbjct: 314 VESVVVDYRYRGRGIGTHLMEEVEKYCKVMMNINHMYIATDG 355 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 680,355 Number of Sequences: 2352 Number of extensions: 13712 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -