BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30699 (443 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g07220.1 68414.m00768 expressed protein 40 6e-04 At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to ... 29 1.9 At5g42370.1 68418.m05159 expressed protein 29 1.9 At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identic... 29 1.9 At2g19150.1 68415.m02235 pectinesterase family protein contains ... 29 1.9 At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipox... 28 2.5 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 28 3.3 At5g22390.1 68418.m02612 expressed protein 27 4.3 At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical... 27 4.3 At3g56510.1 68416.m06284 TBP-binding protein, putative similar t... 27 5.7 At2g05210.1 68415.m00549 expressed protein 27 5.7 At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase fa... 27 5.7 At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase fa... 27 5.7 At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-P... 27 7.5 At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-con... 27 7.5 At1g50410.1 68414.m05650 SNF2 domain-containing protein / helica... 27 7.5 At4g02680.1 68417.m00363 tetratricopeptide repeat (TPR)-containi... 26 10.0 At3g04340.1 68416.m00459 FtsH protease family protein similar to... 26 10.0 At1g60230.1 68414.m06783 radical SAM domain-containing protein ... 26 10.0 >At1g07220.1 68414.m00768 expressed protein Length = 507 Score = 40.3 bits (90), Expect = 6e-04 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 1/88 (1%) Frame = -1 Query: 443 RIRFPSKPDTPRSSEPILIPKLRIQFADFP-YLHYSID*RLFTLETCCGYGYEPARHLHV 267 R+R P K +PRS +L+ L + F F L Y +D + +T G+ EP H+ Sbjct: 6 RLRLPHK-SSPRSPSYLLLCVLALSFFSFTALLFYKVDDFIAQTKTLAGHNLEPTPW-HI 63 Query: 266 HPSPEFSRSAESIRTPPQMRCSSRSEPY 183 P FS + + + ++CS S PY Sbjct: 64 FPRKSFSAATKHSQAYRILQCSYFSCPY 91 >At5g45900.1 68418.m05645 autophagy 7 (APG7) nearly identical to autophagy 7 [Arabidopsis thaliana] GI:19912147; contains Pfam profile PF00899: ThiF family Length = 697 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 241 PQRVSGHRRKCGALRVPNHISLL*DSMELERSGRKENSSRTSRRR 107 P ++G CG +V NH++LL +S+ L+ ++S +R + Sbjct: 42 PISITGFYGPCGHPQVSNHLTLLSESLPLDEQSLIASTSHGNRNK 86 >At5g42370.1 68418.m05159 expressed protein Length = 447 Score = 28.7 bits (61), Expect = 1.9 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 180 PFYRIPWNSNAQAEKKTLPGPLGGVFRPL-WVTPSNTR 70 P Y + + Q+ +K +P PL + R L W TPS R Sbjct: 285 PLYDVTSSGLVQSVEKVVPRPLRSIVRLLFWYTPSTMR 322 >At3g13320.1 68416.m01677 calcium exchanger (CAX2) almost identical to low affinity calcium antiporter CAX2 (GI:1488267) [Arabidopsis thaliana]; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 441 Score = 28.7 bits (61), Expect = 1.9 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +1 Query: 43 SIIVPSSLKTSVRRGNPKWPEDAAERSGKSFLFC--LSVRVPWNPI 174 S++ SL TS + PK P+++ S K +FC L++ +P+ P+ Sbjct: 41 SLMEQGSLSTSFPQHTPKAPKNSVLNSIKIVIFCNKLNLLLPFGPL 86 >At2g19150.1 68415.m02235 pectinesterase family protein contains Pfam profile: PF01095 pectinesterase Length = 339 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 211 ICGGVRILSADLENSGEGCTWRCRAGSYPYPQQV 312 I GG+ + ++ EGCT + R G YP P +V Sbjct: 185 ISGGIDFIFGGAQSIFEGCTLKLRVGIYP-PNEV 217 >At1g72520.1 68414.m08386 lipoxygenase, putative similar to lipoxygenase gi:1495804 [Solanum tuberosum], gi:1654140 [Lycopersicon esculentum], GB:CAB56692 [Arabidopsis thaliana] Length = 926 Score = 28.3 bits (60), Expect = 2.5 Identities = 14/33 (42%), Positives = 19/33 (57%) Frame = -1 Query: 236 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQK 138 +S + P R ++PYLPS G RTLR+K Sbjct: 215 QSQKDHPSKRILFTNQPYLPSETPSGLRTLREK 247 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.9 bits (59), Expect = 3.3 Identities = 28/105 (26%), Positives = 40/105 (38%), Gaps = 5/105 (4%) Frame = -1 Query: 302 GYGYEPARHLHVHPSPEFSRSAESIRTPPQMRCSSRS-EPYLPSI--GFHGTRTLRQKRK 132 G+G P++ PSP F +++ + P S+ P P+I GT T Sbjct: 410 GFGISPSQPNPFSPSPAFGQTSANPTNPFSSSTSTNPFAPQTPTIASSSFGTATSNFGSS 469 Query: 131 LFPDLSAASSGHFGLPRRTLVFKDEGTIIETVPLP--GSGIGTGF 3 F S+++ G T VF T P P GS GF Sbjct: 470 PFGVTSSSNLFGSGSSTTTSVFGSSSAFGTTTPSPLFGSSSTPGF 514 >At5g22390.1 68418.m02612 expressed protein Length = 202 Score = 27.5 bits (58), Expect = 4.3 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 115 ERSGKSFLFCLSVRVPWNPIEG 180 + S KSFL LS PWNP +G Sbjct: 17 DNSPKSFLDTLSSSSPWNPSKG 38 >At1g10930.1 68414.m01255 DNA helicase (RECQl4A) nearly identical to DNA Helicase [Arabidopsis thaliana] GI:11121449 Length = 1188 Score = 27.5 bits (58), Expect = 4.3 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -1 Query: 278 HLHVHPSPEFSRSAESIRTPPQMRCSSRSE 189 H H +P+ S S S+RTPP R +SR E Sbjct: 229 HYHSTSTPQPSVSNFSLRTPPVDRSASRLE 258 >At3g56510.1 68416.m06284 TBP-binding protein, putative similar to TBP-binding protein ABT1 GI:6518527 from [Mus musculus] Length = 257 Score = 27.1 bits (57), Expect = 5.7 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = -3 Query: 207 VLFAFRTISPFYRIPWNSNAQAEKKTLPGPLGGVFRPLWVTPSNTRF*RRGNDY*NGSAA 28 +L + + Y P +S AQ +K G G F WV + +R D NG Sbjct: 69 ILAQYGELGRIYLAPEDSEAQVHRKRAGGFRGQRFSEGWVEFAKKSVAKRVADMLNGEQI 128 Query: 27 GFRNRNRI 4 G + ++ + Sbjct: 129 GGKKKSSV 136 >At2g05210.1 68415.m00549 expressed protein Length = 364 Score = 27.1 bits (57), Expect = 5.7 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -1 Query: 236 ESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHFGLPR 81 +S T C+ +E Y +GF T TLR+KR L S +F PR Sbjct: 282 DSTATLEAFLCNKDAE-YFWGLGFQDTETLRKKRNWL--LGIRESSNFVAPR 330 >At2g03890.2 68415.m00352 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 530 Score = 27.1 bits (57), Expect = 5.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 163 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 44 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At2g03890.1 68415.m00351 phosphatidylinositol 3- and 4-kinase family protein low similarity to phosphatidylinositol 4-kinase type-II beta [Homo sapiens] GI:20159767; contains Pfam profile PF00454: Phosphatidylinositol 3- and 4-kinase Length = 650 Score = 27.1 bits (57), Expect = 5.7 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = -2 Query: 163 MELERSGRKENSSRTSRRRLQATLGYPVEHSFLKTRERLL 44 MEL+RS ++ T +RRLQ L +P E S L + +L Sbjct: 60 MELDRS----DNVHTVKRRLQIALNFPTEESSLTYGDMVL 95 >At5g56500.1 68418.m07051 chaperonin, putative similar to SWISS-PROT:P08927- RuBisCO subunit binding-protein beta subunit, chloroplast precursor (60 kDa chaperonin beta subunit, CPN-60 beta) [Pisum sativum]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 597 Score = 26.6 bits (56), Expect = 7.5 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -1 Query: 242 SAESIRTPPQMRCSSRSEPYLPSIGFHGTRTLRQKRKLFPDLSAASSGHF 93 S S PP R SS + S F T+++ Q++ FP + AA HF Sbjct: 10 SMGSSLAPPSNRLSSFVS--ISSSSFGRTQSIAQRKARFPKIYAAKQLHF 57 >At3g02270.1 68416.m00208 eIF4-gamma/eIF5/eIF2-epsilon domain-containing protein similar to SP|Q13144 Translation initiation factor eIF-2B epsilon subunit (eIF-2B GDP-GTP exchange factor) {Homo sapiens}; contains Pfam profile PF02020: eIF4-gamma/eIF5/eIF2-epsilon Length = 676 Score = 26.6 bits (56), Expect = 7.5 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 197 RSEPYLPSIGFHGTRTLRQKRK 132 R+ PY+P + F G RTL+ +R+ Sbjct: 288 RTFPYVPDMKFSGNRTLKLERQ 309 >At1g50410.1 68414.m05650 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 981 Score = 26.6 bits (56), Expect = 7.5 Identities = 14/43 (32%), Positives = 19/43 (44%) Frame = -2 Query: 343 ILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSGHRR 215 I TR P G++RRD+ST PH +GH + Sbjct: 15 IQETRTRPQHPPRIAEGSHRRDLSTLRPHFLSGSSSGANGHTK 57 >At4g02680.1 68417.m00363 tetratricopeptide repeat (TPR)-containing protein contains Pfam profile PF00515 TPR Domain Length = 888 Score = 26.2 bits (55), Expect = 10.0 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 2/90 (2%) Frame = -2 Query: 367 LPTSLTYIILSTRGSSPWRPAADMGTNRRDISTYIPHLNFQGPQRVSGHRRKCGALRVPN 188 +P + +T SSP AA + TNR + + G ++++ RRK +L P Sbjct: 151 VPLDIASYFPATTASSP--EAASVKTNRSVSKNVVFKI---GEEKIACQRRKIASLSAPF 205 Query: 187 HISLL*DSME--LERSGRKENSSRTSRRRL 104 H L + E L+ EN +S R+ Sbjct: 206 HAMLYGNFTESLLDEIDMSENHVSSSAMRV 235 >At3g04340.1 68416.m00459 FtsH protease family protein similar to chloroplast FtsH protease [Arabidopsis thaliana] GI:1483215; contains Pfam profiles PF01434: Peptidase family M41, PF00004: ATPase AAA family Length = 960 Score = 26.2 bits (55), Expect = 10.0 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +1 Query: 34 GTVSIIVPSSLKTSVRRGNPKWPEDA 111 G ++VP +++ +R G KW E+A Sbjct: 81 GEKEVVVPKAIQLHLRHGWKKWQEEA 106 >At1g60230.1 68414.m06783 radical SAM domain-containing protein contains Pfam profile PF04055: radical SAM domain protein Length = 458 Score = 26.2 bits (55), Expect = 10.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -1 Query: 128 FPDLSAASSGHFGLPRRTLVFKDEGTIIETVPLP 27 F D+ +AS G R+ L D+G +IETV +P Sbjct: 161 FKDIRSASDG----TRKILFTLDDGLVIETVVIP 190 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,000,103 Number of Sequences: 28952 Number of extensions: 245443 Number of successful extensions: 771 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 746 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 771 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 712739520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -