BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30697 (342 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28292| Best HMM Match : RVT_1 (HMM E-Value=2.3e-38) 33 0.080 SB_20701| Best HMM Match : DUF1027 (HMM E-Value=2.4) 28 2.3 SB_33056| Best HMM Match : DUF635 (HMM E-Value=8.7) 27 3.0 SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) 27 3.0 SB_35199| Best HMM Match : zf-CCHC (HMM E-Value=0.034) 27 3.0 SB_35506| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.3 SB_59688| Best HMM Match : K-box (HMM E-Value=0.25) 26 7.0 SB_54104| Best HMM Match : PolyA_pol (HMM E-Value=1.29998e-41) 26 9.2 SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 >SB_28292| Best HMM Match : RVT_1 (HMM E-Value=2.3e-38) Length = 469 Score = 32.7 bits (71), Expect = 0.080 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +2 Query: 20 TPLTRISNKLGRNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 154 T LT+ ++ RNV+ + H IPGE+ I N Y+L Y Sbjct: 36 TKLTKEEGEIQRNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 80 >SB_20701| Best HMM Match : DUF1027 (HMM E-Value=2.4) Length = 229 Score = 27.9 bits (59), Expect = 2.3 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 53 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 154 RNV+ + H IPGE+ I N Y+L Y Sbjct: 186 RNVIRERAKFHQRSQIPGESAESFIRNLYELAEY 219 >SB_33056| Best HMM Match : DUF635 (HMM E-Value=8.7) Length = 189 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 53 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 154 RNV+ + H IPGE+ I N Y+L Y Sbjct: 129 RNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 162 >SB_28181| Best HMM Match : RVP (HMM E-Value=0.00058) Length = 664 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 53 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 154 RNV+ + H IPGE+ I N Y+L Y Sbjct: 75 RNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 108 >SB_35199| Best HMM Match : zf-CCHC (HMM E-Value=0.034) Length = 327 Score = 27.5 bits (58), Expect = 3.0 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 53 RNVVTNFVRNHSNGGIPGENLPFDIHNRYKLTLY 154 RNV+ + H IPGE+ I N Y+L Y Sbjct: 75 RNVIHERAKFHQRSQIPGESAESFIRNLYELAEY 108 >SB_35506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 4 KRKDDYPIDSHLKQIGQKCGN 66 K+KDD P+DS +K+I Q N Sbjct: 34 KQKDDEPVDSFIKKITQALVN 54 >SB_59688| Best HMM Match : K-box (HMM E-Value=0.25) Length = 884 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 128 ECRRVDSRQEYRR*NGFSRNSLPHFCPICL 39 ECRR+ + R N F R+++ H P+ L Sbjct: 194 ECRRLSREEIERERNNFFRSTVSHGSPLSL 223 >SB_54104| Best HMM Match : PolyA_pol (HMM E-Value=1.29998e-41) Length = 466 Score = 25.8 bits (54), Expect = 9.2 Identities = 14/33 (42%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +1 Query: 19 YPIDS-HLKQIGQKCGNEFREKPF*RRYSWRES 114 +P+ HLK IG K G EF + WRES Sbjct: 415 FPVTGDHLKSIGLKPGPEFGRTLSQLKQMWRES 447 >SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 454 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +2 Query: 8 VKMITPLTRISNK-LGRNVVTNFVRNHSNGG 97 V ++ P R N+ +G+ NFV H NGG Sbjct: 123 VNLLLPAHRNKNRFIGKVAEVNFVEIHQNGG 153 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,791,724 Number of Sequences: 59808 Number of extensions: 188258 Number of successful extensions: 399 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 376 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 399 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 498218920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -