BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30696 (710 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_13925| Best HMM Match : No HMM Matches (HMM E-Value=.) 59 3e-09 SB_24591| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 8e-07 SB_24775| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.043 SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) 29 2.8 SB_46939| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_20803| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-06) 29 3.7 SB_18548| Best HMM Match : Peptidase_A17 (HMM E-Value=1.6e-18) 29 3.7 SB_40870| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.9 SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_38994| Best HMM Match : Integrin_beta (HMM E-Value=0) 28 6.5 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.6 >SB_13925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 317 Score = 59.3 bits (137), Expect = 3e-09 Identities = 32/89 (35%), Positives = 50/89 (56%) Frame = +2 Query: 236 LYDNDGKRYLDLFGGIVTVSVGHCHPKVNAALKDQLDVLWHTTNLYRHPKIYEYVEQLAA 415 ++D GKRY+D V+ GHCHP++ AL+DQ +L T+ + + + E+ ++ Sbjct: 1 MWDVTGKRYIDFLAAYSAVNQGHCHPRIVKALQDQAGILSLTSRAFYNDVLGEF-QEFVT 59 Query: 416 KLPGDLNVVYLVNSGSEANELATLLAKAY 502 KL G + V VNSG E E A LA+ + Sbjct: 60 KLCG-YDKVLPVNSGVEGGETACKLARKW 87 >SB_24591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 343 Score = 51.2 bits (117), Expect = 8e-07 Identities = 19/55 (34%), Positives = 33/55 (60%) Frame = +2 Query: 80 STAKMPPTDFVPRPYTGPSYQQVEQMKGVYMPPSITNAYKKPVLLTQGHMQWLYD 244 ST +MPP D+ P PY G S+ + +Q++ Y+ P++ YK P+ + +W+ D Sbjct: 31 STLEMPPCDYKPEPYKGMSFDKAKQIRQTYLNPALLAYYKDPIFIWAVITKWIQD 85 >SB_24775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 35.5 bits (78), Expect = 0.043 Identities = 15/37 (40%), Positives = 24/37 (64%) Frame = +2 Query: 233 WLYDNDGKRYLDLFGGIVTVSVGHCHPKVNAALKDQL 343 ++ D D KRY+D G + +GH HP+V A+++QL Sbjct: 43 YVTDEDDKRYVDYVGSWGPMILGHSHPEVLDAVRNQL 79 >SB_13937| Best HMM Match : zf-CCCH (HMM E-Value=0.0017) Length = 1495 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 30 KWLIEEQNYASTSSERTARPKCRRRISCPDRTRDLRTNK 146 KWL ++N A SS T K + S PD T+ NK Sbjct: 716 KWLQSQKNQAPNSSSETKDSKWPQAPSIPDNTQTNEPNK 754 >SB_46939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 29.1 bits (62), Expect = 3.7 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +1 Query: 478 GDFAGESVHRKPRHHIAADQLPRLHQQPHGL 570 GD +G++ HR RHH Q +L +PHGL Sbjct: 143 GD-SGKNDHRTSRHHWRNRQHSKLELRPHGL 172 >SB_20803| Best HMM Match : Exo_endo_phos (HMM E-Value=3.2e-06) Length = 563 Score = 29.1 bits (62), Expect = 3.7 Identities = 20/73 (27%), Positives = 35/73 (47%) Frame = +2 Query: 446 LVNSGSEANELATLLAKAYTGNLDIISLQTSYHGYTSSLMGLTATQSYRMAIPVPPGFYH 625 LVNS +E + L ++ +GN D ++ S T S++G++ T + Y+ Sbjct: 290 LVNSKTEKGSILHLNTRSLSGNFDKVTNLLSTLNLTFSMIGISETWLKNVCHSCDIPGYN 349 Query: 626 AVHPDPFRXAFGG 664 VH +P + GG Sbjct: 350 YVH-EPRKGRTGG 361 >SB_18548| Best HMM Match : Peptidase_A17 (HMM E-Value=1.6e-18) Length = 550 Score = 29.1 bits (62), Expect = 3.7 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 452 SLNIPRSNPPGA*RLIVRRTHRFSDVCTGWSYATI 348 SL+IPR PPG R++ H F+D Y + Sbjct: 418 SLHIPRCFPPGFGRMVRTDIHHFADASQDNGYGAV 452 >SB_40870| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 28.7 bits (61), Expect = 4.9 Identities = 11/35 (31%), Positives = 22/35 (62%) Frame = +2 Query: 233 WLYDNDGKRYLDLFGGIVTVSVGHCHPKVNAALKD 337 ++ D DG LD++ I ++ +G+ HP + A++D Sbjct: 157 YVVDADGNVMLDVYQQIASIPLGYNHPALLKAMQD 191 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/57 (31%), Positives = 25/57 (43%) Frame = +3 Query: 12 QQRNTSKWLIEEQNYASTSSERTARPKCRRRISCPDRTRDLRTNK*NK*KEFTCRLQ 182 ++ L+EEQ S S T R C S +RT D N+ KE C+L+ Sbjct: 1355 EEMKNESMLVEEQLNESQSELETTRESCTSMNSDLERTCDELQIAQNELKELRCQLE 1411 >SB_28495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6753 Score = 28.3 bits (60), Expect = 6.5 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 206 VLLTQGHMQWLYDNDGKRYLDLFGGIVTVSVGHCHPK 316 VLLT G Q L KR D IV+V VG C+ K Sbjct: 4068 VLLTDGQSQDLVFTAAKRLRDAGVTIVSVGVGCCYSK 4104 >SB_38994| Best HMM Match : Integrin_beta (HMM E-Value=0) Length = 467 Score = 28.3 bits (60), Expect = 6.5 Identities = 18/59 (30%), Positives = 30/59 (50%) Frame = +2 Query: 275 GGIVTVSVGHCHPKVNAALKDQLDVLWHTTNLYRHPKIYEYVEQLAAKLPGDLNVVYLV 451 GGIVT + G CH N+ + + D L + + H K+ + Q + G++ +YLV Sbjct: 166 GGIVTPNDGQCHLS-NSGVYTKSDELDYPSIAQLHEKLLQKQIQPIFAVTGNVTDLYLV 223 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.9 bits (59), Expect = 8.6 Identities = 19/62 (30%), Positives = 30/62 (48%) Frame = +1 Query: 124 HGTFVPTSRTNERSLHAAFNHERL*EAGASHPGAHAVVIRQRRQEIPGSVRWNRHRLRGP 303 HG + PT T+ L+A+ + AG+ HP HAV + +P + W LR P Sbjct: 495 HGMY-PTVPTSSALLNASA--VPVPGAGSPHPHYHAVQGANGQYSVPCNCTWQPQDLRRP 551 Query: 304 LS 309 ++ Sbjct: 552 VA 553 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,468,186 Number of Sequences: 59808 Number of extensions: 572093 Number of successful extensions: 1532 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1532 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -