BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30692 (712 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 23 2.5 AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory recept... 22 5.7 AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory recept... 21 7.5 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 23.0 bits (47), Expect = 2.5 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = -1 Query: 148 LYVPSIWKLTIFL*IVLINRKLFAK 74 L + ++WKLTIFL + ++ +L +K Sbjct: 5 LSLVTLWKLTIFLSSMCLDPRLNSK 29 >AM292356-1|CAL23168.2| 251|Tribolium castaneum gustatory receptor candidate 35 protein. Length = 251 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 395 TISVFSGYENLVLDFVII-FQVFIMGFFCS 309 T+ SG+EN V +++ F+ ++ FFCS Sbjct: 27 TVVEESGFENFVKTYLVSDFENYVT-FFCS 55 >AM292349-1|CAL23161.1| 248|Tribolium castaneum gustatory receptor candidate 28 protein. Length = 248 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 344 IFQVFIMGFFC 312 IF F+MG FC Sbjct: 75 IFGAFVMGLFC 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,627 Number of Sequences: 336 Number of extensions: 3415 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18843005 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -