BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30691 (681 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 23 1.8 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 23 1.8 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 23 2.3 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 9.3 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 432 PVCKWTDSTEVSKQNGEYRR 491 PV WT+ TEV+K + R Sbjct: 137 PVAAWTNGTEVAKFKNMWTR 156 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 23.4 bits (48), Expect = 1.8 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 432 PVCKWTDSTEVSKQNGEYRR 491 PV WT+ TEV+K + R Sbjct: 137 PVAAWTNGTEVAKFKNMWTR 156 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 23.0 bits (47), Expect = 2.3 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = -3 Query: 505 EAKFHRRYSPFCLLTSVLSV 446 + K H+ Y P LL+ +L + Sbjct: 3 QVKLHKHYVPIILLSKILGI 22 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.0 bits (42), Expect = 9.3 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 92 FTDKLCREYLKCVFLINKD*VFKKSVIRTIMTSTLS 199 F DK +YL VF KK +IR LS Sbjct: 233 FVDKTASDYLINVFKTTLQEREKKKIIRNDFIDLLS 268 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,284 Number of Sequences: 336 Number of extensions: 3048 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17801955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -