BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30680 (794 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 1.2 EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxy... 23 2.8 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 3.7 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 21 8.6 AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory recept... 21 8.6 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 375 CKPALCFAFLTCSKLKPKGKPDSTALN 295 C P L L C K PK +P T L+ Sbjct: 719 CSPDLYAVMLNCWKECPKNRPTFTELS 745 >EF592178-1|ABQ95974.1| 532|Tribolium castaneum tyrosine hydroxylase protein. Length = 532 Score = 23.0 bits (47), Expect = 2.8 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 342 CSKLKPKGKPDSTALNPASLAKAYRSKMEE 253 C+ L K +PD +P K YR++ +E Sbjct: 206 CNHLMTKYEPDLDMNHPGFADKEYRARRKE 235 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 22.6 bits (46), Expect = 3.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +2 Query: 626 LIEPINQYSMPKYFLSDYG 682 LIE + Y PK LSD+G Sbjct: 247 LIEDFSGYIKPKCVLSDHG 265 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 613 EYPRTNRTNQPVFYAQIFL 669 EY RT N+P +A++ L Sbjct: 348 EYTRTTHPNEPGRFAKLLL 366 >AM292362-1|CAL23174.2| 398|Tribolium castaneum gustatory receptor candidate 41 protein. Length = 398 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = -1 Query: 131 ICSRTVYNKVRSEMIDSTLVHSFYCWVRVNKYHK 30 ICS TV + + ++++L+HS + + K H+ Sbjct: 180 ICSYTVLIRNKISNLNTSLIHSTHLNGDIVKEHQ 213 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,585 Number of Sequences: 336 Number of extensions: 3788 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -