BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30680 (794 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10650.1 68417.m01739 GTP-binding family protein contains Pfa... 33 0.29 At4g10080.1 68417.m01649 expressed protein 31 0.88 At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-... 30 2.0 At5g05410.1 68418.m00583 DRE-binding protein (DREB2A) identical ... 28 6.2 At1g30670.1 68414.m03750 basic helix-loop-helix (bHLH) family pr... 28 6.2 At3g14620.1 68416.m01851 cytochrome P450, putative similar to GB... 28 8.2 At2g16860.1 68415.m01939 GCIP-interacting family protein similar... 28 8.2 At1g37130.1 68414.m04639 nitrate reductase 2 (NR2) identical to ... 28 8.2 >At4g10650.1 68417.m01739 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 332 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/37 (37%), Positives = 26/37 (70%) Frame = -2 Query: 298 KSSVFSQSISFQNGRSFSKHKRQISTEFHYNKILYDL 188 KS ++S+S ++ +S +KHKRQ +T+ + I+YD+ Sbjct: 237 KSQDLTESLSDESSKSDAKHKRQYATDHTQDFIVYDV 273 >At4g10080.1 68417.m01649 expressed protein Length = 325 Score = 31.1 bits (67), Expect = 0.88 Identities = 37/145 (25%), Positives = 64/145 (44%), Gaps = 10/145 (6%) Frame = +2 Query: 248 EASSILERYALAKD---AGFKAVESGFPFGFSLE---QVRNAKQ---SAGLQQIAINLKT 400 E+SS+++ + D A + +ESG+ F ++ + N + +GL Q +++ Sbjct: 26 ESSSVIDDGMILSDHFSATDRVIESGYFDSFRVDYGSECLNPGEVSVDSGLDQFSVSQSG 85 Query: 401 GDTTKGEVGVTSVPGKEDEFKTNLNTTIEYAKALDAKKIHIMAG-KVENPTPKHWETFEK 577 D + E GV E + + +A + K + A ++ T H+ET + Sbjct: 86 DDCVRNEFGVYD---SETGILGDGEVRLSDFEAANEKYVESEAATELTGGTVSHYET--E 140 Query: 578 NLLYAVDVLKGENIQGLIEPINQYS 652 NL VD GEN G+ EPI S Sbjct: 141 NLEEFVDGRHGENESGVEEPIEDSS 165 >At5g50780.1 68418.m06291 ATP-binding region, ATPase-like domain-containing protein low similarity to microrchidia [Homo sapiens] GI:5410257; contains Pfam profile PF02518: ATPase, histidine kinase-, DNA gyrase B-, and HSP90-like domain protein Length = 823 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +2 Query: 278 LAKDAGFKAVESGFPFGFSLEQVRNAKQSAGLQQIAINLKTGD---TTKGEVGVTSVPGK 448 ++KD G+K+ E G G S + + G + + + D + E VT +PGK Sbjct: 647 VSKDIGYKSSEKGGKLGNSFSKSNKRAKPQGARAVEVTNSDDDYDCDSSPERNVTELPGK 706 Query: 449 EDE 457 E Sbjct: 707 SSE 709 >At5g05410.1 68418.m00583 DRE-binding protein (DREB2A) identical to DREB2A GI:3738230 from [Arabidopsis thaliana] ; supported by cDNA:gi_3738229_dbj_AB007790.1_AB007790 Length = 335 Score = 28.3 bits (60), Expect = 6.2 Identities = 20/62 (32%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Frame = +2 Query: 554 KHW-ETFEKNLLYAVDVLKG---ENIQGLIEPINQYSMPKYFLSDYGRAVDIIK-RIDSP 718 KHW FE N Y D+LK + QG++E Q ++DYG D+ + +DS Sbjct: 199 KHWLSEFEHN--YWSDILKEKEKQKEQGIVETCQQQQQDSLSVADYGWPNDVDQSHLDSS 256 Query: 719 NL 724 ++ Sbjct: 257 DM 258 >At1g30670.1 68414.m03750 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 264 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/49 (34%), Positives = 28/49 (57%) Frame = -2 Query: 304 SLKSSVFSQSISFQNGRSFSKHKRQISTEFHYNKILYDLFSRL*EVNYV 158 S K+ VF++S + + KH++ I + FH+N +D FS E NY+ Sbjct: 53 SPKTRVFNESQELDSFHT-PKHQKLIDSSFHFNS--HDPFSPSPESNYL 98 >At3g14620.1 68416.m01851 cytochrome P450, putative similar to GB:Q05047 from [Catharanthus roseus] Length = 515 Score = 27.9 bits (59), Expect = 8.2 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -2 Query: 289 VFSQSISFQNGRSFSKHKRQISTEFHYNKI 200 +F+ ++ G +SKH++ I+ FH K+ Sbjct: 139 LFATGVALYEGEKWSKHRKIINPSFHLEKL 168 >At2g16860.1 68415.m01939 GCIP-interacting family protein similar to GCIP-interacting protein mp29 (GI:27372623) [Mus musculus]; similar to GCIP-interacting protein P29 (GI:11967379) [Homo sapiens] Length = 298 Score = 27.9 bits (59), Expect = 8.2 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +2 Query: 539 ENPTPKHWETFEKNLLYAVDVLKGENIQGLIEPINQ 646 + PTP W+ F + LY + +NIQ +E N+ Sbjct: 169 KEPTPAGWDVFNQKTLYNAYKKRTKNIQVDLEEYNR 204 >At1g37130.1 68414.m04639 nitrate reductase 2 (NR2) identical to SP|P11035 Nitrate reductase 2 (formerly EC 1.6.6.1) (NR2) {Arabidopsis thaliana} Length = 917 Score = 27.9 bits (59), Expect = 8.2 Identities = 18/75 (24%), Positives = 34/75 (45%), Gaps = 3/75 (4%) Frame = +2 Query: 437 VPGKEDEFKTNLNTTIEYAKALDAKKIHIMAGKVENPTPKHWETFEKNLLYAVDVLKGEN 616 VPG+ D K + N T L K+H V + ET N +Y ++++ N Sbjct: 28 VPGRSDSPKAHQNQTTNQTVFLKPAKVHDDDEDVSSEDEN--ETHNSNAVYYKEMIRKSN 85 Query: 617 IQ---GLIEPINQYS 652 + +++P ++Y+ Sbjct: 86 AELEPSVLDPRDEYT 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,558,826 Number of Sequences: 28952 Number of extensions: 304373 Number of successful extensions: 838 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 819 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -