BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30673 (742 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 26 1.1 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 26 1.4 AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin s... 25 2.5 AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein ... 25 3.2 CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 5.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 5.7 AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 23 7.5 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 9.9 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 26.2 bits (55), Expect = 1.1 Identities = 16/58 (27%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +2 Query: 305 PSVKKSKSDPEKGSNSEKADFERAIELTGYGRF-HYMLLAVCGLVSTSEEMDVISMSF 475 PS + K P N AIEL GRF H ++ + E++ I +F Sbjct: 35 PSASQPKQKPAPAFNPRAGRMPNAIELESIGRFKHAEMMPILRETVKKEDVQRIRTNF 92 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/40 (27%), Positives = 16/40 (40%) Frame = -1 Query: 226 LGPRVSFYHPMRAGGFVWWSRGHSNVSHWGEWRYQQRIAC 107 LG HP+ G VW+ + HW + + I C Sbjct: 417 LGAACGRIHPVGTGPMVWYQIFEYAIGHWLQKATEHVIGC 456 >AF492464-1|AAM11657.1| 803|Anopheles gambiae beta nu integrin subunit AgBnu protein. Length = 803 Score = 25.0 bits (52), Expect = 2.5 Identities = 11/39 (28%), Positives = 21/39 (53%) Frame = +1 Query: 616 HSHLHSERARHRRLLLQSELRALHVLPLRERXRLGRVGT 732 +S L E+ R +L A+ ++P + RLG++G+ Sbjct: 86 YSFLQIEKNEPHRDFDSQQLEAVQIMPQKMNLRLGKLGS 124 >AY263176-1|AAP78791.1| 705|Anopheles gambiae TmcB-like protein protein. Length = 705 Score = 24.6 bits (51), Expect = 3.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 131 ALPTAYSLPVTIRCASSLLFVSV 63 +LP AY L +TI ++ +FVSV Sbjct: 200 SLPHAYFLTITILLLATFVFVSV 222 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.8 bits (49), Expect = 5.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 46 AT*SGGTLTNNKEEAHRIVTGKLYAVGSATPP 141 AT G T+ EAH I G V + PP Sbjct: 1206 ATLGGNATTSTSNEAHVIANGHDGPVSAGKPP 1237 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.8 bits (49), Expect = 5.7 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = -2 Query: 369 SKSAFSELEPFSGSDFDFLTEGT 301 S SAF E PFSG F T Sbjct: 1437 SSSAFFEFIPFSGKQFQMCFSAT 1459 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 23.4 bits (48), Expect = 7.5 Identities = 12/49 (24%), Positives = 25/49 (51%) Frame = -3 Query: 218 PGQFLPSYAGGRLCMVVAGTLKRLSLGGVALPTAYSLPVTIRCASSLLF 72 P FLP G R+C+ + + ++ +G V++ A+ T + ++F Sbjct: 441 PYTFLPFGEGPRVCIGMRFGMMQVKVGLVSMVRAFRFLPTAQTPDRIVF 489 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 9.9 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -1 Query: 166 RGHSNVSHWGEWRY 125 RGHS + H EW++ Sbjct: 30 RGHSTIVHLFEWKW 43 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 796,381 Number of Sequences: 2352 Number of extensions: 17741 Number of successful extensions: 64 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -