BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30667 (696 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49937-8|CAD44113.1| 546|Caenorhabditis elegans Hypothetical pr... 27 9.7 Z49867-4|CAD44109.1| 546|Caenorhabditis elegans Hypothetical pr... 27 9.7 AL033514-27|CAA22088.1| 363|Caenorhabditis elegans Hypothetical... 27 9.7 AF067618-1|AAC19199.2| 1174|Caenorhabditis elegans Hypothetical ... 27 9.7 >Z49937-8|CAD44113.1| 546|Caenorhabditis elegans Hypothetical protein C33D3.5 protein. Length = 546 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 385 SSLNYGYDSQKSRKKSIKYKGGVCFLNFQIK 293 S +NYG D +K R+ S+ + G+ + Q+K Sbjct: 354 SPINYGMDVEKIRENSVIFYNGISSMLAQLK 384 >Z49867-4|CAD44109.1| 546|Caenorhabditis elegans Hypothetical protein C33D3.5 protein. Length = 546 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 385 SSLNYGYDSQKSRKKSIKYKGGVCFLNFQIK 293 S +NYG D +K R+ S+ + G+ + Q+K Sbjct: 354 SPINYGMDVEKIRENSVIFYNGISSMLAQLK 384 >AL033514-27|CAA22088.1| 363|Caenorhabditis elegans Hypothetical protein Y75B8A.28 protein. Length = 363 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +2 Query: 176 CNNNDQWLKED**LRLSYCNRYFMDKLIWNNIEFSY 283 CNNN +WL+E R + N F++ L NI FS+ Sbjct: 96 CNNNGEWLQEYSQARKIFKNIVFLNFLAKKNI-FSF 130 >AF067618-1|AAC19199.2| 1174|Caenorhabditis elegans Hypothetical protein F56H1.3 protein. Length = 1174 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 120 HENNKRGRDFRRDNDLTFDVTITTSGSKKINDCD 221 HE R +DF+ + ++ T S K NDCD Sbjct: 192 HEAQTRDKDFKIGQKIPYESFETISSKIKNNDCD 225 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,496,666 Number of Sequences: 27780 Number of extensions: 250061 Number of successful extensions: 517 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 511 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -