BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30661 (791 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05070.1 68416.m00550 expressed protein 72 5e-13 At3g05670.1 68416.m00631 PHD finger family protein contains Pfam... 31 1.2 At3g20150.1 68416.m02554 kinesin motor family protein contains P... 28 6.2 >At3g05070.1 68416.m00550 expressed protein Length = 144 Score = 71.7 bits (168), Expect = 5e-13 Identities = 38/90 (42%), Positives = 60/90 (66%) Frame = +3 Query: 237 PKPKFRSYKPQDEALQESKLNDAEPTVIEEEVKDLLEAGKEKVVLQDLDITSLAPRKPDW 416 P KFR+Y PQ + LQ+ KL E E+ + L A ++K +D ++AP+KP+W Sbjct: 45 PAMKFRNYVPQAKELQDGKLAPPELPKFEDPIVALPPAVEKK---ED-PFVNIAPKKPNW 100 Query: 417 DLKRDVAKKLERLERKTQRAIAELIWDRLK 506 DL+RDV KKL++LER+TQ+A+ +L+ ++ K Sbjct: 101 DLRRDVQKKLDKLERRTQKAMHKLMEEQEK 130 >At3g05670.1 68416.m00631 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 883 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +3 Query: 237 PKPKFRSYKPQDEALQESKLNDAEPTVIEEEVKDLLEAG 353 P+P+ R P D + S +D E T+ EEE + + EAG Sbjct: 326 PRPRRRCTVPSDSDVASSGESDYEYTISEEEREQIREAG 364 >At3g20150.1 68416.m02554 kinesin motor family protein contains Pfam domain, PF00225: Kinesin motor domain Length = 1114 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = +3 Query: 420 LKRDVAKKLERLERKTQRAIAELIWDRLKHGNEDNLSAMITMTANRPTITDDD 578 L R V + + E +T++ + +RL NE+ L + IT T + I+DDD Sbjct: 778 LTRLVGQHKLQTEDETEKLMGASNGERLPSANENQLLSCITETYDVKQISDDD 830 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,248,132 Number of Sequences: 28952 Number of extensions: 255425 Number of successful extensions: 748 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 725 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1785055200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -