BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30658 (792 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 52 7e-07 SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) 48 7e-06 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 7e-06 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 9e-06 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 47 2e-05 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 47 2e-05 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 47 2e-05 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 47 2e-05 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 46 3e-05 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 46 5e-05 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) 46 5e-05 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 46 5e-05 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) 46 5e-05 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 5e-05 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 45 6e-05 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 45 6e-05 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) 45 6e-05 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 45 8e-05 SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 44 1e-04 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 44 1e-04 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) 44 1e-04 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 44 1e-04 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) 44 1e-04 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 44 1e-04 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 44 1e-04 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 44 1e-04 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 44 1e-04 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 44 1e-04 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 44 1e-04 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 44 1e-04 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 44 1e-04 SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 44 1e-04 SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 44 1e-04 SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9296| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_4657| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_1863| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_524| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 44 2e-04 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 44 2e-04 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52596| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_50614| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_49201| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_48738| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_46112| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45949| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_45361| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_36087| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_32750| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_30165| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26870| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_20053| Best HMM Match : DUF765 (HMM E-Value=3.9) 44 2e-04 SB_19538| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18780| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_18776| Best HMM Match : DUF765 (HMM E-Value=4) 44 2e-04 SB_16339| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_15013| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_13185| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12908| Best HMM Match : Drf_FH1 (HMM E-Value=4.9) 44 2e-04 SB_12393| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_12282| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_9445| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_8422| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_6419| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_4499| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_3957| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_2671| Best HMM Match : Amidohydro_2 (HMM E-Value=5.6) 44 2e-04 SB_1805| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1746| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_1736| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_261| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 43 2e-04 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 43 2e-04 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 43 2e-04 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 43 2e-04 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 43 2e-04 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 43 2e-04 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 43 2e-04 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 43 2e-04 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 43 2e-04 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 43 2e-04 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 43 2e-04 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 43 2e-04 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 43 2e-04 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 43 2e-04 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 43 2e-04 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 43 2e-04 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 43 2e-04 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 43 2e-04 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 43 2e-04 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 43 2e-04 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 43 2e-04 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 43 2e-04 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_57700| Best HMM Match : Parecho_VpG (HMM E-Value=7.7) 43 2e-04 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 43 2e-04 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55208| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 43 2e-04 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54383| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_54347| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53639| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53521| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53415| Best HMM Match : efhand (HMM E-Value=2.7e-12) 43 2e-04 SB_53321| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_53245| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52926| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52745| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52722| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52633| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_52392| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 51.6 bits (118), Expect = 7e-07 Identities = 23/31 (74%), Positives = 24/31 (77%) Frame = -2 Query: 104 FSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 F+ FD N S V NSCSPGDPLVLERPPPR Sbjct: 2 FNCNFDSNMCSFVSNSCSPGDPLVLERPPPR 32 >SB_26956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 2e-06 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = -2 Query: 92 FDENDESLVPNSCSPGDPLVLERPPPR 12 FDEN + NSCSPGDPLVLERPPPR Sbjct: 6 FDENVRCDISNSCSPGDPLVLERPPPR 32 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 49.6 bits (113), Expect = 3e-06 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 113 ESRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 ++ F F +D + V NSCSPGDPLVLERPPPR Sbjct: 102 DTTFQRRFTASDTNEVSNSCSPGDPLVLERPPPR 135 >SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 48.4 bits (110), Expect = 7e-06 Identities = 22/32 (68%), Positives = 23/32 (71%) Frame = -2 Query: 107 RFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 R TL +ND NSCSPGDPLVLERPPPR Sbjct: 25 RVGTLDFQNDCFYTSNSCSPGDPLVLERPPPR 56 >SB_32763| Best HMM Match : Histone_HNS (HMM E-Value=0.15) Length = 481 Score = 48.4 bits (110), Expect = 7e-06 Identities = 20/29 (68%), Positives = 24/29 (82%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL ++ +E+ NSCSPGDPLVLERPPPR Sbjct: 347 TLEEKTNEASASNSCSPGDPLVLERPPPR 375 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 48.4 bits (110), Expect = 7e-06 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N L+ NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIVFLISNSCSPGDPLVLERPPPR 35 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 48.0 bits (109), Expect = 9e-06 Identities = 18/25 (72%), Positives = 22/25 (88%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 +N + ++ NSCSPGDPLVLERPPPR Sbjct: 114 KNQKEIISNSCSPGDPLVLERPPPR 138 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 48.0 bits (109), Expect = 9e-06 Identities = 22/32 (68%), Positives = 24/32 (75%) Frame = -2 Query: 107 RFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 R S L ++ LV NSCSPGDPLVLERPPPR Sbjct: 14 RISVLALKSRPMLVSNSCSPGDPLVLERPPPR 45 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 47.6 bits (108), Expect = 1e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = -2 Query: 92 FDENDESLVPNSCSPGDPLVLERPPPR 12 F N+ S NSCSPGDPLVLERPPPR Sbjct: 6 FRYNNTSFTSNSCSPGDPLVLERPPPR 32 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 T + + S+V NSCSPGDPLVLERPPPR Sbjct: 338 TQYPQYLHSIVSNSCSPGDPLVLERPPPR 366 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 33 SLISNSCSPGDPLVLERPPPR 53 >SB_16044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 47.2 bits (107), Expect = 2e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N ++ NSCSPGDPLVLERPPPR Sbjct: 7 TLISANITNISSNSCSPGDPLVLERPPPR 35 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E +V NSCSPGDPLVLERPPPR Sbjct: 4 EGIVSNSCSPGDPLVLERPPPR 25 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 32 SLISNSCSPGDPLVLERPPPR 52 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL+ NSCSPGDPLVLERPPPR Sbjct: 30 SLISNSCSPGDPLVLERPPPR 50 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 47.2 bits (107), Expect = 2e-05 Identities = 19/30 (63%), Positives = 24/30 (80%) Frame = -2 Query: 101 STLFDENDESLVPNSCSPGDPLVLERPPPR 12 +T F +++ + NSCSPGDPLVLERPPPR Sbjct: 34 ATSFRTSNKPTISNSCSPGDPLVLERPPPR 63 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/25 (80%), Positives = 20/25 (80%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 E S V NSCSPGDPLVLERPPPR Sbjct: 9 ERSASQVSNSCSPGDPLVLERPPPR 33 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = -2 Query: 110 SRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 S+F D +L NSCSPGDPLVLERPPPR Sbjct: 2 SKFDYETDALPTALTSNSCSPGDPLVLERPPPR 34 >SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) Length = 332 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/30 (63%), Positives = 23/30 (76%) Frame = -2 Query: 101 STLFDENDESLVPNSCSPGDPLVLERPPPR 12 ++ F N ++ NSCSPGDPLVLERPPPR Sbjct: 11 TSYFLRNSSNISSNSCSPGDPLVLERPPPR 40 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/25 (80%), Positives = 21/25 (84%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 E +E V NSCSPGDPLVLERPPPR Sbjct: 1060 ELEEKEVSNSCSPGDPLVLERPPPR 1084 >SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) Length = 176 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/59 (38%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = -2 Query: 182 VQRNCLQNHPFSNKLLEQIN*QNE--SRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 ++ +N P+ ++ E+ +N+ + TL + + + + NSCSPGDPLVLERPPPR Sbjct: 13 IETGLYKNLPYELRICEKCE-KNKVGDEYHTLMECDYVNDISNSCSPGDPLVLERPPPR 70 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 DE + NSCSPGDPLVLERPPPR Sbjct: 47 DEIKISNSCSPGDPLVLERPPPR 69 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.8 bits (106), Expect = 2e-05 Identities = 23/32 (71%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 104 FSTLFDENDE-SLVPNSCSPGDPLVLERPPPR 12 FSTL +N L NSCSPGDPLVLERPPPR Sbjct: 22 FSTLKTKNAPLKLSSNSCSPGDPLVLERPPPR 53 >SB_33980| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.8 bits (106), Expect = 2e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N + NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIGPITSNSCSPGDPLVLERPPPR 35 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 3/27 (11%) Frame = -2 Query: 83 NDESLVP---NSCSPGDPLVLERPPPR 12 N SLVP NSCSPGDPLVLERPPPR Sbjct: 18 NGASLVPRPSNSCSPGDPLVLERPPPR 44 >SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 46.4 bits (105), Expect = 3e-05 Identities = 20/29 (68%), Positives = 22/29 (75%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N + + NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIDIPLSNSCSPGDPLVLERPPPR 35 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 46.4 bits (105), Expect = 3e-05 Identities = 23/32 (71%), Positives = 25/32 (78%) Frame = -2 Query: 107 RFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 RFS+L N+ S NSCSPGDPLVLERPPPR Sbjct: 14 RFSSLHKINNLS---NSCSPGDPLVLERPPPR 42 >SB_17747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/29 (75%), Positives = 23/29 (79%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TLF EN + NSCSPGDPLVLERPPPR Sbjct: 46 TLFIEN-RLMRSNSCSPGDPLVLERPPPR 73 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 46.4 bits (105), Expect = 3e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 +SL NSCSPGDPLVLERPPPR Sbjct: 13 KSLTSNSCSPGDPLVLERPPPR 34 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 24 LVSNSCSPGDPLVLERPPPR 43 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/47 (48%), Positives = 27/47 (57%), Gaps = 2/47 (4%) Frame = -2 Query: 146 NKLLEQIN*QNESRFSTLFDENDESLVP--NSCSPGDPLVLERPPPR 12 + L + N E L+ D + P NSCSPGDPLVLERPPPR Sbjct: 2 SSLTKSSNDPRELYLGLLYPTEDYKVYPVSNSCSPGDPLVLERPPPR 48 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 3 LVSNSCSPGDPLVLERPPPR 22 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 17 LVSNSCSPGDPLVLERPPPR 36 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 9 LVSNSCSPGDPLVLERPPPR 28 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 46.0 bits (104), Expect = 4e-05 Identities = 21/35 (60%), Positives = 21/35 (60%) Frame = -2 Query: 116 NESRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 N R T E NSCSPGDPLVLERPPPR Sbjct: 12 NICRVRTQIAEKHVKFTSNSCSPGDPLVLERPPPR 46 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 5 LVSNSCSPGDPLVLERPPPR 24 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 2 LVSNSCSPGDPLVLERPPPR 21 >SB_32720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 46.0 bits (104), Expect = 4e-05 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = -2 Query: 143 KLLEQIN*QNESRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 + + IN Q+ ++ N+ SL NSCSPGDPLVLERPPPR Sbjct: 61 RTFKSINGQSITQLGIHSGLNEHSL-SNSCSPGDPLVLERPPPR 103 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 LV NSCSPGDPLVLERPPPR Sbjct: 26 LVSNSCSPGDPLVLERPPPR 45 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.0 bits (104), Expect = 4e-05 Identities = 17/22 (77%), Positives = 21/22 (95%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 ++++ NSCSPGDPLVLERPPPR Sbjct: 2 QTIISNSCSPGDPLVLERPPPR 23 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 +N + L NSCSPGDPLVLERPPPR Sbjct: 208 QNGKHLRSNSCSPGDPLVLERPPPR 232 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E L NSCSPGDPLVLERPPPR Sbjct: 5 EPLASNSCSPGDPLVLERPPPR 26 >SB_3293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/22 (86%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 ES+ NSCSPGDPLVLERPPPR Sbjct: 32 ESIRSNSCSPGDPLVLERPPPR 53 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 17 LISNSCSPGDPLVLERPPPR 36 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 37 LISNSCSPGDPLVLERPPPR 56 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E ++ NSCSPGDPLVLERPPPR Sbjct: 53 EPILSNSCSPGDPLVLERPPPR 74 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 ++V NSCSPGDPLVLERPPPR Sbjct: 76 TIVSNSCSPGDPLVLERPPPR 96 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 8 LISNSCSPGDPLVLERPPPR 27 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -2 Query: 95 LFDENDESLVPNSCSPGDPLVLERPPPR 12 +F ND V NSCSPGDPLVLERPPPR Sbjct: 4 IFVSNDA--VSNSCSPGDPLVLERPPPR 29 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 24 LISNSCSPGDPLVLERPPPR 43 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E L NSCSPGDPLVLERPPPR Sbjct: 15 EVLASNSCSPGDPLVLERPPPR 36 >SB_34396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/29 (68%), Positives = 21/29 (72%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N + NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIGEVGSNSCSPGDPLVLERPPPR 35 >SB_34241| Best HMM Match : RuvA_C (HMM E-Value=1.5) Length = 274 Score = 45.6 bits (103), Expect = 5e-05 Identities = 22/42 (52%), Positives = 28/42 (66%) Frame = -2 Query: 137 LEQIN*QNESRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 L++I E+ + L D + + NSCSPGDPLVLERPPPR Sbjct: 127 LQEIMDSEENLDNILRDLEEVANSSNSCSPGDPLVLERPPPR 168 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 40 LISNSCSPGDPLVLERPPPR 59 >SB_28183| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 D N NSCSPGDPLVLERPPPR Sbjct: 11 DSNQRPRESNSCSPGDPLVLERPPPR 36 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 70 LISNSCSPGDPLVLERPPPR 89 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.6 bits (103), Expect = 5e-05 Identities = 21/36 (58%), Positives = 25/36 (69%) Frame = -2 Query: 119 QNESRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 +N ++ + F EN NSCSPGDPLVLERPPPR Sbjct: 38 KNTTKDAEFFAENGSE--SNSCSPGDPLVLERPPPR 71 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 + +V NSCSPGDPLVLERPPPR Sbjct: 83 QRIVSNSCSPGDPLVLERPPPR 104 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 ++V NSCSPGDPLVLERPPPR Sbjct: 12 NIVSNSCSPGDPLVLERPPPR 32 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = -2 Query: 107 RFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 + +TLF + + + NSCSPGDPLVLERPPPR Sbjct: 26 KLNTLFIPSTQ-MASNSCSPGDPLVLERPPPR 56 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 21 LISNSCSPGDPLVLERPPPR 40 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 N L NSCSPGDPLVLERPPPR Sbjct: 657 NSLQLASNSCSPGDPLVLERPPPR 680 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 + +V NSCSPGDPLVLERPPPR Sbjct: 25 QKVVSNSCSPGDPLVLERPPPR 46 >SB_7770| Best HMM Match : Aldolase_II (HMM E-Value=2.6e-12) Length = 716 Score = 45.6 bits (103), Expect = 5e-05 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 +E +E + NSCSPGDPLVLERPPPR Sbjct: 260 EELEEIVGSNSCSPGDPLVLERPPPR 285 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/33 (54%), Positives = 24/33 (72%) Frame = -2 Query: 110 SRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 + +S ++ ++ NSCSPGDPLVLERPPPR Sbjct: 12 TNYSNCLNKCHNIVISNSCSPGDPLVLERPPPR 44 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.6 bits (103), Expect = 5e-05 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 ++ L NSCSPGDPLVLERPPPR Sbjct: 7 HESGLTSNSCSPGDPLVLERPPPR 30 >SB_2166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.6 bits (103), Expect = 5e-05 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIRVFESNSCSPGDPLVLERPPPR 35 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 DE + NSCSPGDPLVLERPPPR Sbjct: 55 DEPTAKKLSNSCSPGDPLVLERPPPR 80 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +L+ NSCSPGDPLVLERPPPR Sbjct: 61 TLLSNSCSPGDPLVLERPPPR 81 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/23 (78%), Positives = 21/23 (91%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 +++L NSCSPGDPLVLERPPPR Sbjct: 20 NDALSSNSCSPGDPLVLERPPPR 42 >SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) Length = 128 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL NSCSPGDPLVLERPPPR Sbjct: 3 SLSSNSCSPGDPLVLERPPPR 23 >SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 45.2 bits (102), Expect = 6e-05 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = -2 Query: 92 FDENDESLVPNSCSPGDPLVLERPPPR 12 F E S NSCSPGDPLVLERPPPR Sbjct: 3 FFEGSLSYQSNSCSPGDPLVLERPPPR 29 >SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 ND NSCSPGDPLVLERPPPR Sbjct: 5 NDGIKTSNSCSPGDPLVLERPPPR 28 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 6e-05 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +++ NSCSPGDPLVLERPPPR Sbjct: 12 NIISNSCSPGDPLVLERPPPR 32 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +L+ NSCSPGDPLVLERPPPR Sbjct: 1 TLLSNSCSPGDPLVLERPPPR 21 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 +V NSCSPGDPLVLERPPPR Sbjct: 11 MVSNSCSPGDPLVLERPPPR 30 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E L NSCSPGDPLVLERPPPR Sbjct: 83 EPLSSNSCSPGDPLVLERPPPR 104 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 +V NSCSPGDPLVLERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 ++V NSCSPGDPLVLERPPPR Sbjct: 18 TVVSNSCSPGDPLVLERPPPR 38 >SB_39278| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 ES NSCSPGDPLVLERPPPR Sbjct: 7 ESYPSNSCSPGDPLVLERPPPR 28 >SB_39012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E+ + NSCSPGDPLVLERPPPR Sbjct: 43 EAALSNSCSPGDPLVLERPPPR 64 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 + L NSCSPGDPLVLERPPPR Sbjct: 9 QELTSNSCSPGDPLVLERPPPR 30 >SB_27903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 SL NSCSPGDPLVLERPPPR Sbjct: 5 SLSSNSCSPGDPLVLERPPPR 25 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/21 (90%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S V NSCSPGDPLVLERPPPR Sbjct: 15 SKVSNSCSPGDPLVLERPPPR 35 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/26 (73%), Positives = 21/26 (80%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 D ++ L NSCSPGDPLVLERPPPR Sbjct: 82 DASNLLLTSNSCSPGDPLVLERPPPR 107 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 +V NSCSPGDPLVLERPPPR Sbjct: 1 MVSNSCSPGDPLVLERPPPR 20 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 45.2 bits (102), Expect = 6e-05 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +++ NSCSPGDPLVLERPPPR Sbjct: 12 NIISNSCSPGDPLVLERPPPR 32 >SB_4204| Best HMM Match : DUF765 (HMM E-Value=8) Length = 144 Score = 45.2 bits (102), Expect = 6e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S+ NSCSPGDPLVLERPPPR Sbjct: 18 SITSNSCSPGDPLVLERPPPR 38 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 17 IISNSCSPGDPLVLERPPPR 36 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 +++ NSCSPGDPLVLERPPPR Sbjct: 35 DNIASNSCSPGDPLVLERPPPR 56 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 D S NSCSPGDPLVLERPPPR Sbjct: 30 DISKTSNSCSPGDPLVLERPPPR 52 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S + NSCSPGDPLVLERPPPR Sbjct: 57 SSISNSCSPGDPLVLERPPPR 77 >SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 1/27 (3%) Frame = -2 Query: 89 DENDESL-VPNSCSPGDPLVLERPPPR 12 ++ DE L NSCSPGDPLVLERPPPR Sbjct: 4 NKRDERLSTSNSCSPGDPLVLERPPPR 30 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 +V NSCSPGDPLVLERPPPR Sbjct: 3474 VVSNSCSPGDPLVLERPPPR 3493 >SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S + NSCSPGDPLVLERPPPR Sbjct: 2 SQISNSCSPGDPLVLERPPPR 22 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 14 IISNSCSPGDPLVLERPPPR 33 >SB_52028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 D + + + NSCSPGDPLVLERPPPR Sbjct: 16 DRDTDRHLSNSCSPGDPLVLERPPPR 41 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +L NSCSPGDPLVLERPPPR Sbjct: 5 TLASNSCSPGDPLVLERPPPR 25 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 +V NSCSPGDPLVLERPPPR Sbjct: 7 VVSNSCSPGDPLVLERPPPR 26 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 54 LLSNSCSPGDPLVLERPPPR 73 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 + V NSCSPGDPLVLERPPPR Sbjct: 17 AFVSNSCSPGDPLVLERPPPR 37 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 6 LLSNSCSPGDPLVLERPPPR 25 >SB_40987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/26 (69%), Positives = 19/26 (73%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 + E NSCSPGDPLVLERPPPR Sbjct: 45 ERKTEDTTSNSCSPGDPLVLERPPPR 70 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 5 IISNSCSPGDPLVLERPPPR 24 >SB_38625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E++ NSCSPGDPLVLERPPPR Sbjct: 43 ETVPSNSCSPGDPLVLERPPPR 64 >SB_36435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 + ++ NSCSPGDPLVLERPPPR Sbjct: 43 ESTITSNSCSPGDPLVLERPPPR 65 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +++ NSCSPGDPLVLERPPPR Sbjct: 4 NVISNSCSPGDPLVLERPPPR 24 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 1 MISNSCSPGDPLVLERPPPR 20 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/48 (47%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = -2 Query: 152 FSNKLLEQIN*QNESRFSTLFDE-NDESLVPNSCSPGDPLVLERPPPR 12 ++ KL+E+ + + + TL E NSCSPGDPLVLERPPPR Sbjct: 20 YNRKLIERNGNDHRTFWKTLKKILPGEKKTSNSCSPGDPLVLERPPPR 67 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -2 Query: 107 RFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 + S+ ++ NSCSPGDPLVLERPPPR Sbjct: 5 KMSSASSTTSAPVISNSCSPGDPLVLERPPPR 36 >SB_18933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S+ NSCSPGDPLVLERPPPR Sbjct: 6 SVTSNSCSPGDPLVLERPPPR 26 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 1 LLSNSCSPGDPLVLERPPPR 20 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 1/21 (4%) Frame = -2 Query: 71 LVP-NSCSPGDPLVLERPPPR 12 LVP NSCSPGDPLVLERPPPR Sbjct: 27 LVPSNSCSPGDPLVLERPPPR 47 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L+ NSCSPGDPLVLERPPPR Sbjct: 7 LLSNSCSPGDPLVLERPPPR 26 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +L NSCSPGDPLVLERPPPR Sbjct: 2 TLASNSCSPGDPLVLERPPPR 22 >SB_9153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S + NSCSPGDPLVLERPPPR Sbjct: 4 SKISNSCSPGDPLVLERPPPR 24 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 26 IISNSCSPGDPLVLERPPPR 45 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 44.8 bits (101), Expect = 8e-05 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +L NSCSPGDPLVLERPPPR Sbjct: 95 ALASNSCSPGDPLVLERPPPR 115 >SB_175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.8 bits (101), Expect = 8e-05 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIIVYTSNSCSPGDPLVLERPPPR 35 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/24 (75%), Positives = 19/24 (79%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 N + NSCSPGDPLVLERPPPR Sbjct: 96 NKSLKISNSCSPGDPLVLERPPPR 119 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E ++ NSCSPGDPLVLERPPPR Sbjct: 90 EWVLSNSCSPGDPLVLERPPPR 111 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +++ NSCSPGDPLVLERPPPR Sbjct: 12 NILSNSCSPGDPLVLERPPPR 32 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 2 VSNSCSPGDPLVLERPPPR 20 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 +N ++ NSCSPGDPLVLERPPPR Sbjct: 33 KNHKNYRSNSCSPGDPLVLERPPPR 57 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 + + NSCSPGDPLVLERPPPR Sbjct: 80 QQMASNSCSPGDPLVLERPPPR 101 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 40 VSNSCSPGDPLVLERPPPR 58 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 184 VSNSCSPGDPLVLERPPPR 202 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) Length = 280 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = -2 Query: 119 QNESRFSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 Q+++ + E+ + NSCSPGDPLVLERPPPR Sbjct: 139 QSKANGDSFLCEDAVAFPSNSCSPGDPLVLERPPPR 174 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 14 VISNSCSPGDPLVLERPPPR 33 >SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/24 (79%), Positives = 19/24 (79%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 N E NSCSPGDPLVLERPPPR Sbjct: 10 NPEVGTSNSCSPGDPLVLERPPPR 33 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 78 LTSNSCSPGDPLVLERPPPR 97 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 214 VSNSCSPGDPLVLERPPPR 232 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 5 LASNSCSPGDPLVLERPPPR 24 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 5 VSNSCSPGDPLVLERPPPR 23 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 3 VSNSCSPGDPLVLERPPPR 21 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 7 VSNSCSPGDPLVLERPPPR 25 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/27 (66%), Positives = 20/27 (74%) Frame = -2 Query: 92 FDENDESLVPNSCSPGDPLVLERPPPR 12 F + + NSCSPGDPLVLERPPPR Sbjct: 4 FSPKHKKSLSNSCSPGDPLVLERPPPR 30 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 64 VSNSCSPGDPLVLERPPPR 82 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 25 VSNSCSPGDPLVLERPPPR 43 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 + ++ NSCSPGDPLVLERPPPR Sbjct: 2417 SSSAIASNSCSPGDPLVLERPPPR 2440 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 59 VSNSCSPGDPLVLERPPPR 77 >SB_41354| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/24 (75%), Positives = 20/24 (83%) Frame = -2 Query: 83 NDESLVPNSCSPGDPLVLERPPPR 12 N ++ NSCSPGDPLVLERPPPR Sbjct: 21 NSKATRSNSCSPGDPLVLERPPPR 44 >SB_40734| Best HMM Match : DUF765 (HMM E-Value=0.42) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 +S NSCSPGDPLVLERPPPR Sbjct: 2 QSSTSNSCSPGDPLVLERPPPR 23 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 31 VSNSCSPGDPLVLERPPPR 49 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 41 VSNSCSPGDPLVLERPPPR 59 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 4 VSNSCSPGDPLVLERPPPR 22 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 6 VSNSCSPGDPLVLERPPPR 24 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 15 VSNSCSPGDPLVLERPPPR 33 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 37 LTSNSCSPGDPLVLERPPPR 56 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -2 Query: 92 FDENDESLVPNSCSPGDPLVLERPPPR 12 F + NSCSPGDPLVLERPPPR Sbjct: 24 FSTESPRSISNSCSPGDPLVLERPPPR 50 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 20 LASNSCSPGDPLVLERPPPR 39 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 30 VSNSCSPGDPLVLERPPPR 48 >SB_27240| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 137 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 + + S NSCSPGDPLVLERPPPR Sbjct: 7 DTNVSYTSNSCSPGDPLVLERPPPR 31 >SB_25872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 D + NSCSPGDPLVLERPPPR Sbjct: 17 DLTFTSNSCSPGDPLVLERPPPR 39 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 32 VSNSCSPGDPLVLERPPPR 50 >SB_24514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 402 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 E + NSCSPGDPLVLERPPPR Sbjct: 168 ELFLSNSCSPGDPLVLERPPPR 189 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 14 VSNSCSPGDPLVLERPPPR 32 >SB_21311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -2 Query: 86 ENDESLVPNSCSPGDPLVLERPPPR 12 ++ E NSCSPGDPLVLERPPPR Sbjct: 13 DHTERRASNSCSPGDPLVLERPPPR 37 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 34 VSNSCSPGDPLVLERPPPR 52 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_17821| Best HMM Match : PQ-loop (HMM E-Value=6.7) Length = 176 Score = 44.4 bits (100), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 + + NSCSPGDPLVLERPPPR Sbjct: 50 AFISNSCSPGDPLVLERPPPR 70 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 8 VSNSCSPGDPLVLERPPPR 26 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 23 VSNSCSPGDPLVLERPPPR 41 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 18 VSNSCSPGDPLVLERPPPR 36 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 11 LASNSCSPGDPLVLERPPPR 30 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 27 VSNSCSPGDPLVLERPPPR 45 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 193 VSNSCSPGDPLVLERPPPR 211 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 9 VSNSCSPGDPLVLERPPPR 27 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 17 VSNSCSPGDPLVLERPPPR 35 >SB_5107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.4 bits (100), Expect = 1e-04 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = -2 Query: 104 FSTLFDENDESLVPNSCSPGDPLVLERPPPR 12 F+T F + ++ NSCSPGDPLVLERPPPR Sbjct: 3 FTTHFGLHSQT-TSNSCSPGDPLVLERPPPR 32 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 L NSCSPGDPLVLERPPPR Sbjct: 4 LASNSCSPGDPLVLERPPPR 23 >SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.4 bits (100), Expect = 1e-04 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 V NSCSPGDPLVLERPPPR Sbjct: 10 VSNSCSPGDPLVLERPPPR 28 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 12 NIASNSCSPGDPLVLERPPPR 32 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/33 (66%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -2 Query: 98 TLFDENDESLVP----NSCSPGDPLVLERPPPR 12 TL N S +P NSCSPGDPLVLERPPPR Sbjct: 7 TLISANILSYLPINESNSCSPGDPLVLERPPPR 39 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 ++L NSCSPGDPLVLERPPPR Sbjct: 18 KNLRSNSCSPGDPLVLERPPPR 39 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 261 ISNSCSPGDPLVLERPPPR 279 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 +S NSCSPGDPLVLERPPPR Sbjct: 16 KSSTSNSCSPGDPLVLERPPPR 37 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 18/23 (78%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 D NSCSPGDPLVLERPPPR Sbjct: 6 DAESTSNSCSPGDPLVLERPPPR 28 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S+ NSCSPGDPLVLERPPPR Sbjct: 110 SVESNSCSPGDPLVLERPPPR 130 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/29 (68%), Positives = 20/29 (68%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N NSCSPGDPLVLERPPPR Sbjct: 7 TLISANITWRPSNSCSPGDPLVLERPPPR 35 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S NSCSPGDPLVLERPPPR Sbjct: 12 STASNSCSPGDPLVLERPPPR 32 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.0 bits (99), Expect = 1e-04 Identities = 20/26 (76%), Positives = 20/26 (76%), Gaps = 1/26 (3%) Frame = -2 Query: 86 ENDESLVP-NSCSPGDPLVLERPPPR 12 E S P NSCSPGDPLVLERPPPR Sbjct: 12 ETGRSACPSNSCSPGDPLVLERPPPR 37 >SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 95 LFDENDESLVPNSCSPGDPLVLERPPPR 12 L + N + NSCSPGDPLVLERPPPR Sbjct: 3 LVNSNFWIVTSNSCSPGDPLVLERPPPR 30 >SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 9 ISNSCSPGDPLVLERPPPR 27 >SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 10 ISNSCSPGDPLVLERPPPR 28 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 44.0 bits (99), Expect = 1e-04 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 7/59 (11%) Frame = -2 Query: 167 LQNHPFSNKLLEQ-----IN*QNESRFSTLFDENDE--SLVPNSCSPGDPLVLERPPPR 12 L+ F KLLE + +E + + ++ D+ NSCSPGDPLVLERPPPR Sbjct: 201 LERERFRRKLLETQQELAVAVSSERKKDVMIEQLDKLKKKTSNSCSPGDPLVLERPPPR 259 >SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 3 ISNSCSPGDPLVLERPPPR 21 >SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 13 ISNSCSPGDPLVLERPPPR 31 >SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 16 ISNSCSPGDPLVLERPPPR 34 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S NSCSPGDPLVLERPPPR Sbjct: 64 STTSNSCSPGDPLVLERPPPR 84 >SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -2 Query: 95 LFDENDESLVPNSCSPGDPLVLERPPPR 12 L+ +S NSCSPGDPLVLERPPPR Sbjct: 17 LYKRLSKSKRSNSCSPGDPLVLERPPPR 44 >SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 21 ISNSCSPGDPLVLERPPPR 39 >SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 152 ISNSCSPGDPLVLERPPPR 170 >SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 47 ISNSCSPGDPLVLERPPPR 65 >SB_53743| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 >SB_53325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 4 ISNSCSPGDPLVLERPPPR 22 >SB_52563| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/26 (73%), Positives = 19/26 (73%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 D N NSCSPGDPLVLERPPPR Sbjct: 33 DINPRKPPSNSCSPGDPLVLERPPPR 58 >SB_51146| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_48029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 12 NITSNSCSPGDPLVLERPPPR 32 >SB_47618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S + NSCSPGDPLVLERPPPR Sbjct: 5 SQLSNSCSPGDPLVLERPPPR 25 >SB_45457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 18 ISNSCSPGDPLVLERPPPR 36 >SB_45434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 32 ISNSCSPGDPLVLERPPPR 50 >SB_45029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 20/21 (95%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 +++ NSCSPGDPLVLERPPPR Sbjct: 18 TVLSNSCSPGDPLVLERPPPR 38 >SB_44586| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = -2 Query: 95 LFDENDESLVPNSCSPGDPLVLERPPPR 12 LF + NSCSPGDPLVLERPPPR Sbjct: 47 LFSLQHVRALSNSCSPGDPLVLERPPPR 74 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 974 ISNSCSPGDPLVLERPPPR 992 >SB_43874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 6 ISNSCSPGDPLVLERPPPR 24 >SB_43244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/21 (80%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 3 TIASNSCSPGDPLVLERPPPR 23 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 65 MLSNSCSPGDPLVLERPPPR 84 >SB_42404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/26 (73%), Positives = 20/26 (76%) Frame = -2 Query: 89 DENDESLVPNSCSPGDPLVLERPPPR 12 D D + NSCSPGDPLVLERPPPR Sbjct: 35 DALDTTQGSNSCSPGDPLVLERPPPR 60 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/22 (77%), Positives = 19/22 (86%) Frame = -2 Query: 77 ESLVPNSCSPGDPLVLERPPPR 12 + + NSCSPGDPLVLERPPPR Sbjct: 44 KDIASNSCSPGDPLVLERPPPR 65 >SB_39977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S+ NSCSPGDPLVLERPPPR Sbjct: 3 SIGSNSCSPGDPLVLERPPPR 23 >SB_39395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 ++ + NSCSPGDPLVLERPPPR Sbjct: 7 EDEIRSNSCSPGDPLVLERPPPR 29 >SB_37889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/29 (72%), Positives = 22/29 (75%) Frame = -2 Query: 98 TLFDENDESLVPNSCSPGDPLVLERPPPR 12 TL N +S NSCSPGDPLVLERPPPR Sbjct: 7 TLISANIQS---NSCSPGDPLVLERPPPR 32 >SB_37610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 1 ISNSCSPGDPLVLERPPPR 19 >SB_37411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 5 ISNSCSPGDPLVLERPPPR 23 >SB_29275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 240 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 116 ISNSCSPGDPLVLERPPPR 134 >SB_27295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_27058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 2 ISNSCSPGDPLVLERPPPR 20 >SB_26694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 8 ISNSCSPGDPLVLERPPPR 26 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 90 ISNSCSPGDPLVLERPPPR 108 >SB_17162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/20 (85%), Positives = 19/20 (95%) Frame = -2 Query: 71 LVPNSCSPGDPLVLERPPPR 12 ++ NSCSPGDPLVLERPPPR Sbjct: 104 ILSNSCSPGDPLVLERPPPR 123 >SB_15081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/21 (85%), Positives = 18/21 (85%) Frame = -2 Query: 74 SLVPNSCSPGDPLVLERPPPR 12 S NSCSPGDPLVLERPPPR Sbjct: 13 STASNSCSPGDPLVLERPPPR 33 >SB_14727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = -2 Query: 80 DESLVPNSCSPGDPLVLERPPPR 12 D+ NSCSPGDPLVLERPPPR Sbjct: 50 DKPFRSNSCSPGDPLVLERPPPR 72 >SB_13387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -2 Query: 68 VPNSCSPGDPLVLERPPPR 12 + NSCSPGDPLVLERPPPR Sbjct: 7 ISNSCSPGDPLVLERPPPR 25 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,689,225 Number of Sequences: 59808 Number of extensions: 486307 Number of successful extensions: 3015 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 2898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3011 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -