BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30655 (635 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) 36 0.028 SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) 36 0.028 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.048 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.45 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.45 SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.3 SB_33647| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 50.8 bits (116), Expect = 9e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 50 KKRAPWLILPVVICLSQRLSHACLSASRIKAIPRMA 157 ++ A WLILPVVICLSQRLSHACLS S RMA Sbjct: 126 RRVAIWLILPVVICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 50.0 bits (114), Expect = 2e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +2 Query: 50 KKRAPWLILPVVICLSQRLSHACLSASRIKAIPRMA 157 ++ A WLILPVVICLSQRLSHACLS S RMA Sbjct: 102 RRVAIWLILPVVICLSQRLSHACLSISTRTVKLRMA 137 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -3 Query: 495 DVVAVSQAPSPESNPDSPLPVTTM 424 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 7e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -3 Query: 486 AVSQAPSPESNPDSPLPVTTM 424 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_17017| Best HMM Match : TIL (HMM E-Value=4.8) Length = 171 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +2 Query: 50 KKRAPWLILPVVICLSQRLS 109 ++ A WLILPVVICLSQRLS Sbjct: 147 RRVAIWLILPVVICLSQRLS 166 >SB_35070| Best HMM Match : TIL (HMM E-Value=8.6) Length = 147 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/20 (80%), Positives = 18/20 (90%) Frame = +2 Query: 50 KKRAPWLILPVVICLSQRLS 109 ++ A WLILPVVICLSQRLS Sbjct: 123 RRVAIWLILPVVICLSQRLS 142 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.048 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -1 Query: 485 PFLRLPLRNRTLIPRYP 435 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.45 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 84 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 218 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.45 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 84 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 218 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_32453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -1 Query: 635 PSN--CSSLKYLKCTHSDYEAS*ESRIVIFRHYL-PVPGVGNLRA 510 PSN CS L YL+C +R+++F H L +G RA Sbjct: 523 PSNLRCSILSYLRCNKPPVTIRWRTRLIVFTHLLVSYRSIGGQRA 567 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -3 Query: 504 PSLDVVAVSQAPSPESNPDSPLP 436 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_33647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 27.5 bits (58), Expect = 9.7 Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 2/55 (3%) Frame = +3 Query: 447 NQGSIPEREPEKRLPHPRKAAGAQIT-HSRHG-EVVTKNNDTGLLRGLVIGMSTL 605 N+ +IP+RE E R AAGA I H +H K+ G R L +G L Sbjct: 10 NEKTIPQREVE-RTKKAATAAGASIAEHIKHAIAEQVKHAKPGFSRSLTLGQKLL 63 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,350,873 Number of Sequences: 59808 Number of extensions: 433299 Number of successful extensions: 1155 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1034 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1155 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1596754500 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -